BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0389 (774 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF038612-3|AAB92045.2| 432|Caenorhabditis elegans Hypothetical ... 29 3.7 Z22177-8|CAB76721.1| 136|Caenorhabditis elegans Hypothetical pr... 29 4.9 >AF038612-3|AAB92045.2| 432|Caenorhabditis elegans Hypothetical protein F13B6.3 protein. Length = 432 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -2 Query: 215 VAGTKSSTSFRFKTEDEPTYTLVPGNVPRRRRLQTTATN-TARPKAIIADRHPST 54 V TKS+ F ED P T P P+ TTA T P R P+T Sbjct: 328 VESTKSAYVILFDIEDLPVTTSSPATTPKPTAKPTTAPECTCPPTTFPTTRAPNT 382 >Z22177-8|CAB76721.1| 136|Caenorhabditis elegans Hypothetical protein ZK512.9 protein. Length = 136 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -3 Query: 610 GGVNLTVFHKYIFTIHN*FILQSPNLKTK 524 G N+TVFH ++ ++Q+PN++TK Sbjct: 26 GSTNVTVFHNDYTDSYSTSLIQNPNIRTK 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,593,009 Number of Sequences: 27780 Number of extensions: 296039 Number of successful extensions: 666 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1861650246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -