BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0386 (690 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 49 9e-05 UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 41 0.025 UniRef50_Q179P1 Cluster: Sidestep protein; n=2; Culicidae|Rep: S... 33 6.6 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 49.2 bits (112), Expect = 9e-05 Identities = 27/48 (56%), Positives = 29/48 (60%) Frame = +2 Query: 110 NSQTQPTEFLAGSSQWVAFPIRCRFCEXGLLLGFVLGTSSGLSPVSSP 253 N +TQP +FLAGSSQ F RFCE LLLG VL S LSP P Sbjct: 69 NPKTQPMKFLAGSSQSSRFRSDGRFCEALLLLGLVLANSLRLSPYELP 116 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 41.1 bits (92), Expect = 0.025 Identities = 21/40 (52%), Positives = 26/40 (65%) Frame = +3 Query: 78 SLATKGSTSKLTLRHSPLSFSPDLLSGSRFRSDVDSAXTG 197 SL T G +++ R PLSFSPDLLSGSRFR+ + G Sbjct: 380 SLKTTGHSTENEHRCCPLSFSPDLLSGSRFRTGAEYEMLG 419 >UniRef50_Q179P1 Cluster: Sidestep protein; n=2; Culicidae|Rep: Sidestep protein - Aedes aegypti (Yellowfever mosquito) Length = 910 Score = 33.1 bits (72), Expect = 6.6 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 6/64 (9%) Frame = +3 Query: 12 SSRSTNGAFRYFKHRSPFSSNPSLATK------GSTSKLTLRHSPLSFSPDLLSGSRFRS 173 SS ST+ + HRS S++ + T G KLTLR P PDL+ G + Sbjct: 464 SSSSTHEDHLHHHHRSSSSTSSTSGTSSHNMLLGPNQKLTLRRKPEPPKPDLVDGQLYMY 523 Query: 174 DVDS 185 +DS Sbjct: 524 RIDS 527 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,061,443 Number of Sequences: 1657284 Number of extensions: 10584732 Number of successful extensions: 22616 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22608 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54132236449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -