BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0386 (690 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 23 3.6 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 4.8 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 6.3 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 6.3 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 6.3 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 6.3 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 22 6.3 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 22 6.3 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 22 6.3 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 22 6.3 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 6.3 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 6.3 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 6.3 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 6.3 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 6.3 DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 21 8.4 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 21 8.4 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 22.6 bits (46), Expect = 3.6 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +2 Query: 452 YFNSIVTIL*DAPNESKMARRSCALTLKLLLVFSRTRARTACKKDATYITVCSLP 616 YF++I+ +L + ++++ ++ L F A+ A K +YI SLP Sbjct: 5 YFSAILFLLAISDSQAQEKLKNIYSWKALEFAFPNGYAKLAAIKSGSYIPGASLP 59 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 199 EPVFAESTSDRKRDPLRRSGE 137 EP+ E SDR+R+ + S E Sbjct: 275 EPILTERPSDRQRNEILLSDE 295 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 103 NNNNYKKLQYYNINY 117 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 103 NNNNYKKLQYYNINY 117 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 103 NNNNYKKLQYYNINY 117 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 103 NNNNYKKLQYYNINY 117 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 93 NNNNYKKLQYYNINY 107 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 93 NNNNYKKLQYYNINY 107 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 93 NNNNYKKLQYYNINY 107 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 93 NNNNYKKLQYYNINY 107 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 314 NNNNYKKLQYYNINY 328 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 325 NNNNYKKLQYYNINY 339 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 325 NNNNYKKLQYYNINY 339 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 314 NNNNYKKLQYYNINY 328 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 679 NRKNYLFCQYYNIKW 635 N NY QYYNI + Sbjct: 326 NNNNYKKLQYYNINY 340 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -2 Query: 677 QEKLFILSIL*YQMDVIYNLWVDYKLLYK*HLFCMQY 567 Q+K L I + +++ LW YK ++ QY Sbjct: 85 QQKTSKLKIYKWNNQILHILWTSYKKVFMKDNILRQY 121 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -2 Query: 677 QEKLFILSIL*YQMDVIYNLWVDYKLLYK*HLFCMQY 567 Q+K L I + +++ LW YK ++ QY Sbjct: 68 QQKTSKLKIYKWNNQILHILWTSYKKVFMKDNILRQY 104 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,021 Number of Sequences: 438 Number of extensions: 3480 Number of successful extensions: 20 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -