BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0384 (636 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC869.11 ||SPAC922.08c|amino acid permease, unknown 6|Schizosa... 25 6.9 SPBC359.03c |||amino acid permease, unknown 8|Schizosaccharomyce... 25 9.1 >SPAC869.11 ||SPAC922.08c|amino acid permease, unknown 6|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 25.4 bits (53), Expect = 6.9 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +2 Query: 56 ITPKVPKDVGNSTTSVTPRMAGLRQGSSTKAIP 154 I+P P +GN +TSV+P + +++ ++ K +P Sbjct: 323 ISPDDPNLMGNGSTSVSPFVLAIKE-ANIKGLP 354 >SPBC359.03c |||amino acid permease, unknown 8|Schizosaccharomyces pombe|chr 2|||Manual Length = 579 Score = 25.0 bits (52), Expect = 9.1 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 56 ITPKVPKDVGNSTTSVTPRMAGLRQGSSTKAIP 154 I+P PK +GN + SV+P + + Q ++ K +P Sbjct: 323 ISPDDPKLMGNGSASVSPFVLAI-QEANIKGLP 354 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,380,870 Number of Sequences: 5004 Number of extensions: 45053 Number of successful extensions: 111 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -