BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0384 (636 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1208| Best HMM Match : GRAM (HMM E-Value=0.0034) 31 0.59 SB_36180| Best HMM Match : BRAP2 (HMM E-Value=5.1) 27 9.7 SB_25281| Best HMM Match : DUF497 (HMM E-Value=2) 27 9.7 >SB_1208| Best HMM Match : GRAM (HMM E-Value=0.0034) Length = 1021 Score = 31.5 bits (68), Expect = 0.59 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -1 Query: 309 SGFLKNDLPTFSSQPKARDXTARRRKSHNQVKLGADNFPEP 187 + F K LPTF+ +PK+ + R+ + N K D P P Sbjct: 474 NAFPKPPLPTFTHRPKSCEPVTGRKNAENITKENVDVLPRP 514 >SB_36180| Best HMM Match : BRAP2 (HMM E-Value=5.1) Length = 751 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = -3 Query: 526 RIGXIXTEXIFKXNVRPTGTKKLSRPXFGXWXARINF 416 R+G I E + + LS P +G W ++NF Sbjct: 279 RVGDIFKETVVTHKSAKESRRWLSEPSYGYWPQQLNF 315 >SB_25281| Best HMM Match : DUF497 (HMM E-Value=2) Length = 754 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = -3 Query: 526 RIGXIXTEXIFKXNVRPTGTKKLSRPXFGXWXARINF 416 R+G I E + + LS P +G W ++NF Sbjct: 305 RVGDIFKETVVTHKSAKESRRWLSEPSYGYWPQQLNF 341 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,619,503 Number of Sequences: 59808 Number of extensions: 331808 Number of successful extensions: 826 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -