BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0381 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4072| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_7266| Best HMM Match : UPAR_LY6 (HMM E-Value=0.015) 29 2.7 SB_32327| Best HMM Match : ig (HMM E-Value=7.9e-23) 29 4.7 SB_47223| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_28108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_10846| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_4072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1364 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/68 (27%), Positives = 32/68 (47%) Frame = +2 Query: 188 PKIQYYYDAPAVNVPEMHDQVQSPIITTQVLNIYKTKHLKGMKSVWLPYLLVKKLGSKAM 367 PK+ YYY +P + D+++ +T +LN Y + L LL K SKA Sbjct: 165 PKMIYYYLSPINESLQKLDRMKLLKLTGSLLNRYTNNPVVDSAQEHLDQLLNKSKNSKAF 224 Query: 368 LHPAGSQV 391 + +G+ + Sbjct: 225 IDVSGNPI 232 >SB_7266| Best HMM Match : UPAR_LY6 (HMM E-Value=0.015) Length = 513 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 587 TSLRFMIQGFTGKRFQFSYFFIFEVF 510 TSL + IQ F+G FQFSY+ I +F Sbjct: 283 TSLVYCIQHFSGVIFQFSYYRICALF 308 >SB_32327| Best HMM Match : ig (HMM E-Value=7.9e-23) Length = 932 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 175 ILLRS*DTILLRCSRCKCS*DARPSPIPYY 264 +LLRS D IL R + +CS +A P P+ +Y Sbjct: 714 VLLRSGDVILTRSASLRCSTEAYP-PVTWY 742 >SB_47223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 510 KDLEDEEVRELKALAGKPLYHEP 578 K +DE V E++ L PLYH P Sbjct: 604 KGPQDERVLEVRVLLASPLYHRP 626 >SB_28108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1558 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 370 TPRWQSSEVDDVSAAFLDNLILTQMAQDAQRRREN 474 TPRW+ SE +D +DNL M Q R+++N Sbjct: 21 TPRWELSEEEDSGGCEVDNL----MNQKTNRKQKN 51 >SB_10846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 197 QYYYDAPAVNVPEMHDQVQSPIITTQVLNIYKTKHLKGMKS 319 Q YY + + P+ H QVQ P T L++ + + L+G K+ Sbjct: 15 QPYYTS--YDAPQSHTQVQQPTTDTDQLDMEQLRKLQGKKN 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,904,809 Number of Sequences: 59808 Number of extensions: 406846 Number of successful extensions: 982 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 981 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -