BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0381 (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 4.8 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 6.3 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 6.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 8.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.3 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 247 LVVHLRNIYSGSIVVILYLRSVVIFIIGVLPRYLSPQRP 131 + + + N+ S V R V + I VLPR+L +RP Sbjct: 316 VTIAVLNVNFRSPVTHRMARWVRVVFIQVLPRFLLIERP 354 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 683 KLVLPVVNTSLVSR 642 KLV PVVNTS V R Sbjct: 42 KLVRPVVNTSDVLR 55 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 683 KLVLPVVNTSLVSR 642 KLV PVVNTS V R Sbjct: 42 KLVRPVVNTSDVLR 55 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 110 KTYPMQGWPLWGQVPREYP 166 K YP++ P W V YP Sbjct: 1457 KDYPLRLGPCWHAVMTTYP 1475 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 498 RLRSKDLEDEEVRELKALAGKPLYHEPK 581 RL EDE R A G+P+ P+ Sbjct: 1343 RLAQDSSEDESYRGPSASGGRPVPERPE 1370 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,471 Number of Sequences: 438 Number of extensions: 3749 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -