BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0380 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase... 25 2.3 L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase... 25 2.3 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 25 2.3 >L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 25.0 bits (52), Expect = 2.3 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +3 Query: 414 HTTVCIKEAYSIWIHQVILQMD 479 H + +AY +W Q+I ++D Sbjct: 55 HLFIVTHQAYELWFKQIIFELD 76 >L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 25.0 bits (52), Expect = 2.3 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +3 Query: 414 HTTVCIKEAYSIWIHQVILQMD 479 H + +AY +W Q+I ++D Sbjct: 55 HLFIVTHQAYELWFKQIIFELD 76 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 25.0 bits (52), Expect = 2.3 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -3 Query: 591 CSSFKGEFTVVEGSLRFDIMMSMGLYKH*DQVSDKLVDPSVK 466 CS K FTV+E SLR ++ ++ G + V D L+ +V+ Sbjct: 153 CSD-KSAFTVMEQSLRSNVTVADGSENRVEGVGDCLIKCAVE 193 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 678,324 Number of Sequences: 2352 Number of extensions: 13884 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -