BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0380 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 24 1.6 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 23 2.1 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 2.1 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 2.1 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 2.1 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 6.4 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 265 ETNAKSGIQVNQVYK*YNLVFVVKRY*IHYV 357 +TN K+ + VN+ YK NL + Y HYV Sbjct: 438 QTN-KTWLPVNENYKSLNLAAQKREYYSHYV 467 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 485 LLIHL*NYLMNPN*ISFLNTHCSMNFVTFNSL 390 LL+ + N ++ P ISF N S ++ FN L Sbjct: 96 LLLLVANLIILPVAISFFNDDLSTRWIAFNCL 127 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 485 LLIHL*NYLMNPN*ISFLNTHCSMNFVTFNSL 390 LL+ + N ++ P ISF N S ++ FN L Sbjct: 96 LLLLVANLIILPVAISFFNDDLSTRWIAFNCL 127 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 485 LLIHL*NYLMNPN*ISFLNTHCSMNFVTFNSL 390 LL+ + N ++ P ISF N S ++ FN L Sbjct: 96 LLLLVANLIILPVAISFFNDDLSTRWIAFNCL 127 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -2 Query: 190 VFVTHSSKYFGWLKKKNNPTGNDVYIAILPTSSFQL 83 VF+ + + W K +NP G D +++P ++QL Sbjct: 78 VFLGLNLGFLAWAK--HNPRGKDALWSLVPHMAWQL 111 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = +2 Query: 254 DMRKKQMQSLE 286 D+RKKQ++SLE Sbjct: 372 DLRKKQLKSLE 382 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,175 Number of Sequences: 438 Number of extensions: 4035 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -