BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0373 (473 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 2e-28 SB_17063| Best HMM Match : Ribosomal_S17 (HMM E-Value=5.7e-06) 34 0.052 SB_39731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_797| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) 27 6.0 >SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 122 bits (294), Expect = 2e-28 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 16/101 (15%) Frame = +1 Query: 1 ADQTEKAFQKQATVFLNRKGGM----KRKDMRHHKNVGLGFKTP------------REAI 132 A+QTE+A+QKQA +F NRK + K+KD+R +NVGLGFKTP REAI Sbjct: 2 AEQTERAYQKQAPIFQNRKRVLGQVTKKKDLRFVRNVGLGFKTPKDVCNCTYLLPEREAI 61 Query: 133 EGTYIDKKCPFTGNVSIRGXILTGVVQKMKMQRTIVIRRDY 255 EGTYIDKKCPFTGNVSIRG ILTG+ + MKM+RTI+IRRDY Sbjct: 62 EGTYIDKKCPFTGNVSIRGRILTGICRSMKMKRTIIIRRDY 102 Score = 101 bits (241), Expect = 4e-22 Identities = 39/53 (73%), Positives = 49/53 (92%) Frame = +3 Query: 255 LHYLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 413 LHY+ KYNRFEKRH+N++ H SPCFRD+ +GD++T+G+CRPLSKTVRFNVLKV Sbjct: 103 LHYIKKYNRFEKRHKNLAAHCSPCFRDIALGDLITVGQCRPLSKTVRFNVLKV 155 >SB_17063| Best HMM Match : Ribosomal_S17 (HMM E-Value=5.7e-06) Length = 73 Score = 34.3 bits (75), Expect = 0.052 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +3 Query: 345 GDIVTIGECRPLSKTVRFNVLKV 413 GD+V I ECRPLSK +FNV ++ Sbjct: 29 GDVVRIKECRPLSKMKKFNVEEI 51 >SB_39731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 148 QCRYPQSPLWEF*SLNQHSYGDACP 74 +C QS LWE SL QH Y + P Sbjct: 505 KCNALQSSLWELKSLQQHYYPEVSP 529 >SB_797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 222 DAENYRDPPRLLHYLPKYNRFEKRHRNMSVHLSPCFRDVEI 344 D + Y PPRL+H+ + ++ ++ H+ F D E+ Sbjct: 54 DTDRYLPPPRLIHHAERGSKLQQDASQYQHHVKGNFSDDEL 94 >SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) Length = 3369 Score = 27.5 bits (58), Expect = 6.0 Identities = 22/89 (24%), Positives = 36/89 (40%) Frame = +1 Query: 34 ATVFLNRKGGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKKCPFTGNVSIRGXILTGVVQ 213 A F KG D+ H + G + +E K C F G++ +RG + Sbjct: 11 AKAFAAVKGKKTLPDLHHVTSKDCGRGVHSDGLETPLTIKNCVFAGSM-VRGIDVVSGHV 69 Query: 214 KMKMQRTIVIRRDYFTTYPNTIGSRNGTG 300 + ++ T+V+ TT +G R G G Sbjct: 70 SLTIRDTLVVN----TTNGGGLGIRQGAG 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,958,363 Number of Sequences: 59808 Number of extensions: 269277 Number of successful extensions: 611 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 994359969 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -