BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0372 (541 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 24 1.1 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 2.0 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 21 6.1 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 21 6.1 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 8.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 8.1 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.8 bits (49), Expect = 1.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 81 ADVSHLGXXYKAPQTSYGY 137 AD L YK+PQ +GY Sbjct: 66 ADALWLSPIYKSPQVDFGY 84 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.0 bits (47), Expect = 2.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +3 Query: 324 PLLVRLATETMHLDLDITLVTLIRLAVD*PITTTHIILP 440 PLL + TM LD VT++ L V TH++ P Sbjct: 301 PLLGKFVLFTMILDTFSICVTVVVLNVHFRSPQTHVMAP 339 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 21.4 bits (43), Expect = 6.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 144 YQLGESSSHQQSSKLGDIY 200 YQLG+ + LGDIY Sbjct: 50 YQLGQFLRERYGDFLGDIY 68 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 21.4 bits (43), Expect = 6.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 144 YQLGESSSHQQSSKLGDIY 200 YQLG+ + LGDIY Sbjct: 65 YQLGQFLRERYGDFLGDIY 83 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 8.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 406 INQ*LLPILFYLWRWFQ 456 I+ +LP+ LWRW + Sbjct: 47 ISNDILPVCNGLWRWIR 63 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 8.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 406 INQ*LLPILFYLWRWFQ 456 I+ +LP+ LWRW + Sbjct: 85 ISNDILPVCNGLWRWIR 101 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,866 Number of Sequences: 438 Number of extensions: 2148 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -