BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0371 (681 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 25 0.88 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 25 0.88 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 2.0 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 2.0 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 2.0 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 4.7 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 4.7 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 6.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.2 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 24.6 bits (51), Expect = 0.88 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = -1 Query: 279 YNRDPLGAFFNKVLWQRFNFGGDLFFF 199 Y+ F+N +W RFN ++ + Sbjct: 114 YSAKTFDVFYNTAVWARFNVNEQMYLY 140 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 24.6 bits (51), Expect = 0.88 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = -1 Query: 279 YNRDPLGAFFNKVLWQRFNFGGDLFFF 199 Y+ F+N +W RFN ++ + Sbjct: 114 YSAKTFDVFYNTAVWARFNVNEQMYLY 140 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.0 Identities = 13/63 (20%), Positives = 29/63 (46%) Frame = +3 Query: 339 KSFEQMICKRAEIMNKCFQKYSEQRERRDMKYHKRKLQLQKDFHENDNLNVLKIAKLMNR 518 K E+ ++ ++ ++ S + ER+ KY +R + +D E + KI ++ Sbjct: 28 KLLEERTSRKRYSRSREREQKSYKNERKYRKYRERSKERSRDRTERERSREPKIISSLSN 87 Query: 519 TTV 527 T+ Sbjct: 88 KTI 90 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 23.4 bits (48), Expect = 2.0 Identities = 13/63 (20%), Positives = 29/63 (46%) Frame = +3 Query: 339 KSFEQMICKRAEIMNKCFQKYSEQRERRDMKYHKRKLQLQKDFHENDNLNVLKIAKLMNR 518 K E+ ++ ++ ++ S + ER+ KY +R + +D E + KI ++ Sbjct: 28 KLLEERTSRKRYSRSREREQKSYKNERKYRKYRERSKERSRDRTERERSREPKIISSLSN 87 Query: 519 TTV 527 T+ Sbjct: 88 KTI 90 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 540 LLIIALLFCSSIWLFLIHLNCHFHENPS 457 LL +L SIW+ + LN HF +PS Sbjct: 316 LLFTMILVTLSIWITVCVLNVHF-RSPS 342 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/25 (32%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -3 Query: 274 PRSPRSFLQQGPLATV-QFWRGFVF 203 P++ FL++GP+A + + + G V+ Sbjct: 145 PKNTNKFLEKGPVALINELYPGVVY 169 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -2 Query: 650 FHYNRCIF*YDCQLWPQIELWLY 582 FH R ++ Y+ + I W+Y Sbjct: 276 FHVQRLLYVYEDSTYDDINQWVY 298 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/43 (27%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +3 Query: 405 EQRER--RDMKYHKRKLQLQKDFHENDNLNVLKIAKLMNRTTV 527 EQ E R+M +K + ++D H N + +A L R + Sbjct: 141 EQTEEMYREMLLEHKKRRARRDIHPELNTQGIALADLTQRAQI 183 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 8.2 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 576 SSKILFILSIVCLLI 532 SSKI FILS+V L I Sbjct: 23 SSKIEFILSVVGLAI 37 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 8.2 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 576 SSKILFILSIVCLLI 532 SSKI FILS+V L I Sbjct: 76 SSKIEFILSVVGLAI 90 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,365 Number of Sequences: 438 Number of extensions: 3769 Number of successful extensions: 21 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -