BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0370 (665 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19135| Best HMM Match : Ribosomal_L13e (HMM E-Value=0) 103 1e-22 SB_12085| Best HMM Match : TBP (HMM E-Value=3.5e-35) 32 0.37 SB_34101| Best HMM Match : K_tetra (HMM E-Value=3.5e-40) 32 0.37 SB_16503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_43676| Best HMM Match : Ion_trans (HMM E-Value=1.2e-39) 30 1.9 SB_31789| Best HMM Match : Ion_trans (HMM E-Value=6.3e-37) 30 1.9 SB_53498| Best HMM Match : Ion_trans (HMM E-Value=8.9e-32) 30 1.9 SB_3223| Best HMM Match : Ion_trans (HMM E-Value=0) 29 2.6 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.7 SB_11931| Best HMM Match : Ion_trans (HMM E-Value=0) 28 5.9 SB_13958| Best HMM Match : K_tetra (HMM E-Value=7.00649e-45) 28 7.9 SB_47320| Best HMM Match : Ion_trans (HMM E-Value=2.7e-34) 28 7.9 SB_3220| Best HMM Match : Ion_trans (HMM E-Value=5.6e-22) 28 7.9 >SB_19135| Best HMM Match : Ribosomal_L13e (HMM E-Value=0) Length = 600 Score = 103 bits (247), Expect = 1e-22 Identities = 46/79 (58%), Positives = 55/79 (69%) Frame = +2 Query: 20 KGNNMIPNGHFHKDWQRFVKTWFNQPARRYRRKQNRIKKXXXXXXXXXXXXXXXIVRCPT 199 K NN+IPNGHFHKDWQR+VKTWF+QP R+ RR+ R K IVRCPT Sbjct: 4 KRNNIIPNGHFHKDWQRYVKTWFDQPGRKKRRRVARQIKAAKIAPRPVAGSLRPIVRCPT 63 Query: 200 VRYHTKVRAGRGFTLREIR 256 +Y+TKVRAGRGFTL E++ Sbjct: 64 FKYNTKVRAGRGFTLDELK 82 Score = 80.6 bits (190), Expect = 1e-15 Identities = 41/86 (47%), Positives = 59/86 (68%), Gaps = 1/86 (1%) Frame = +3 Query: 279 ARTIGSAVDPRRRNKSVESLQINVQRIKEYRARLILFP-KGKKVLKGEANEEERKLATQL 455 A TIG AVD RR+N+S ESLQ NVQR+KEY+++LI+FP K K +G++ + A QL Sbjct: 91 APTIGIAVDHRRKNRSAESLQANVQRLKEYKSKLIVFPRKANKPKQGDSEAADLANAVQL 150 Query: 456 RGPLMPVQQPAPKSVARPSLKMKRTS 533 +GP+MP+ Q + ARP + ++ S Sbjct: 151 QGPVMPIPQESVPIKARPITEDEKKS 176 >SB_12085| Best HMM Match : TBP (HMM E-Value=3.5e-35) Length = 440 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 348 VQRIKEYRARLILFPKGKKVLKGEANEEERKLATQ 452 + RI+E R ++F GK V G +EE+ KLA + Sbjct: 319 IMRIREPRTTALIFSSGKMVCTGAKSEEQSKLAAR 353 >SB_34101| Best HMM Match : K_tetra (HMM E-Value=3.5e-40) Length = 440 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 342 FAMIQQTCCVYGDLQHFQSFGQILGSICGLISRRVNPLPARTL 214 +A++ T YGD+ + GQ++GS C ++ V LP L Sbjct: 363 YAIVTMTTTGYGDMTPETAIGQLMGSFCCIVGTLVIALPVPIL 405 >SB_16503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 626 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -3 Query: 342 FAMIQQTCCVYGDLQHFQSFGQILGSICGLISRRVNPLPARTLV 211 +A++ T YGD++ +G+I+GS+C + LP +V Sbjct: 466 WAVVTMTTVGYGDMRPITVWGKIVGSLCAISGVLTIALPVPVIV 509 >SB_43676| Best HMM Match : Ion_trans (HMM E-Value=1.2e-39) Length = 605 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -3 Query: 342 FAMIQQTCCVYGDLQHFQSFGQILGSICGLISRRVNPLPARTL 214 +A+I T YGD+ GQI+GS+C + + LP + Sbjct: 370 WAIITMTTVGYGDMSPKTLSGQIIGSLCAICGVLIIGLPVSVI 412 >SB_31789| Best HMM Match : Ion_trans (HMM E-Value=6.3e-37) Length = 583 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 342 FAMIQQTCCVYGDLQHFQSFGQILGSICGLISRRVNPLP 226 + ++ T YGD+ G+I+GS+C LI + LP Sbjct: 365 YTLVTMTTLGYGDIVPVTFLGKIIGSMCALIGVLLLALP 403 >SB_53498| Best HMM Match : Ion_trans (HMM E-Value=8.9e-32) Length = 294 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 342 FAMIQQTCCVYGDLQHFQSFGQILGSICGLISRRVNPLP 226 + ++ T YGD+ G+I+GS+C LI + LP Sbjct: 180 YTLVTMTTLGYGDITPVTFVGKIIGSMCALIGVLLLALP 218 >SB_3223| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 486 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -3 Query: 342 FAMIQQTCCVYGDLQHFQSFGQILGSICGLISRRVNPLPARTLV 211 +A++ T YGD+ +G+++GSIC + LP +V Sbjct: 372 WAVVTMTTVGYGDMYPVTPWGKLVGSICAISGVLTIALPVPVIV 415 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 26.2 bits (55), Expect(2) = 4.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 272 SICPNDWKCC 301 S C NDWKCC Sbjct: 918 SDCTNDWKCC 927 Score = 20.6 bits (41), Expect(2) = 4.7 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +2 Query: 260 QIEPSICPNDWK 295 +I P CP WK Sbjct: 890 EIRPGKCPKPWK 901 >SB_11931| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 475 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -3 Query: 342 FAMIQQTCCVYGDLQHFQSFGQILGSICGLISRRVNPLPARTLV 211 +A++ T YGDL +G+++GS C L LP +V Sbjct: 414 WALVTMTTVGYGDLVPKTLWGKLVGSCCALCGVLAIALPVPVIV 457 >SB_13958| Best HMM Match : K_tetra (HMM E-Value=7.00649e-45) Length = 623 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -3 Query: 342 FAMIQQTCCVYGDLQHFQSFGQILGSICGLISRRVNPLPARTLV 211 + ++ T YGD+ G+I+GS+C L V LP +V Sbjct: 355 YTIVTMTTLGYGDMVPTTVPGKIVGSLCSLSGVLVIALPVPVIV 398 >SB_47320| Best HMM Match : Ion_trans (HMM E-Value=2.7e-34) Length = 946 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 342 FAMIQQTCCVYGDLQHFQSFGQILGSICGLISRRVNPLP 226 + ++ T YGD+ G+ILG +C L+ V LP Sbjct: 249 YTIVTTTTLGYGDMVPLTVVGKILGGMCCLMGALVVSLP 287 >SB_3220| Best HMM Match : Ion_trans (HMM E-Value=5.6e-22) Length = 256 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = -3 Query: 342 FAMIQQTCCVYGDLQHFQSFGQILGSICGLISRRVNPLPARTLV 211 +A++ T YGD+ +G+I+G++C + LP +V Sbjct: 145 WAVVTMTTVGYGDISPESFWGKIVGALCAISGVLTIALPVPVIV 188 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,529,654 Number of Sequences: 59808 Number of extensions: 380951 Number of successful extensions: 1109 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1014 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1103 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -