BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0370 (665 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.49 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 25 0.86 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 25 0.86 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 2.0 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 3.5 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.4 bits (53), Expect = 0.49 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 123 FCFLRYRRAGWLNQVLTNLCQSLWKC 46 FC+ R A W N V NL SL KC Sbjct: 538 FCYFRRNAATWKNAVRHNL--SLHKC 561 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 24.6 bits (51), Expect = 0.86 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 276 ILGSICGLISRRVNPLPARTLVWYRTVGHRTI 181 IL CG S +N PAR + R+V +TI Sbjct: 300 ILVDDCGCNSTMLNENPARVMACMRSVDAKTI 331 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 24.6 bits (51), Expect = 0.86 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 276 ILGSICGLISRRVNPLPARTLVWYRTVGHRTI 181 IL CG S +N PAR + R+V +TI Sbjct: 300 ILVDDCGCNSTMLNENPARVMACMRSVDAKTI 331 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -3 Query: 300 QHFQSFGQILGSICGLISRRVNPLPARTLVWYR 202 QHFQ + ++C + R +N L +++R Sbjct: 394 QHFQPLNSAVCALCHKVFRTLNSLNNHKSIYHR 426 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.6 bits (46), Expect = 3.5 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 Query: 251 IRPQIEPSICPNDWKC 298 + P I +IC N W C Sbjct: 365 LSPSIHDNICSNGWIC 380 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,472 Number of Sequences: 438 Number of extensions: 3509 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -