BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0369 (716 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC139.06 |hat1|SPAC23C4.01|histone acetyltransferase Hat1|Schi... 29 0.50 SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce... 26 4.7 >SPAC139.06 |hat1|SPAC23C4.01|histone acetyltransferase Hat1|Schizosaccharomyces pombe|chr 1|||Manual Length = 378 Score = 29.5 bits (63), Expect = 0.50 Identities = 10/38 (26%), Positives = 24/38 (63%) Frame = -2 Query: 691 MIQLDKIMRYIYIYNS*SFSG*SFLRIESPQWRVAIIY 578 +++ +IM+++ I++ G SF+ + P+W V ++Y Sbjct: 130 VLEASEIMQHLQIFSLFFIEGGSFIDLNDPRWMVYLLY 167 >SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1610 Score = 26.2 bits (55), Expect = 4.7 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +1 Query: 391 CSEFGLRRLEIRPLGPF*VFSY--TSSLCD*AKHAWNRYLNYVK 516 CSE G++ LE+ P+ F F Y ++ + WN +Y+K Sbjct: 1105 CSESGIKSLELLPVCCFLRFMYYFLPTVFSLSGSYWNSIFDYIK 1148 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,797,229 Number of Sequences: 5004 Number of extensions: 56501 Number of successful extensions: 105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -