BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0369 (716 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0371 + 22774245-22774413,22774504-22774670,22775538-227756... 31 1.2 >11_06_0371 + 22774245-22774413,22774504-22774670,22775538-22775631, 22775723-22775871,22775950-22776042,22776167-22776235, 22776236-22776415,22776465-22776518,22776739-22776905, 22777180-22777314,22777386-22777479,22777567-22777848 Length = 550 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +2 Query: 287 FFFSLSKFTDTG--KFQHTLPKFFF*FNEIILNRIPIVVSSVLDVSKYGL*DLFECSVTR 460 +FFSL FT FQ + KF++ NE +L + +V ++ +VSK G L + R Sbjct: 231 YFFSLVHFTKVVYCHFQVSGSKFYYLKNEAVLLEMALVNWAITEVSKKGFTPLITPEIVR 290 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,584,434 Number of Sequences: 37544 Number of extensions: 309518 Number of successful extensions: 450 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 450 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -