BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0369 (716 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT016091-1|AAV36976.1| 850|Drosophila melanogaster LD39196p pro... 34 0.22 AL021086-6|CAA15931.1| 850|Drosophila melanogaster EG:86E4.5 pr... 34 0.22 AE014298-298|AAF45696.1| 850|Drosophila melanogaster CG3573-PA ... 34 0.22 >BT016091-1|AAV36976.1| 850|Drosophila melanogaster LD39196p protein. Length = 850 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +2 Query: 152 FGRLSFTYSRTPLIKKNHDWFSHMFAFLN*FEMRQSNKKEINVLYFFFSLSK 307 F ++F+Y RTPL N + +FA + F++RQ +K I F S ++ Sbjct: 64 FAIIAFSYLRTPLSSANELIINKVFAIDHNFQLRQDSKSSITTQQFDLSTAE 115 >AL021086-6|CAA15931.1| 850|Drosophila melanogaster EG:86E4.5 protein. Length = 850 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +2 Query: 152 FGRLSFTYSRTPLIKKNHDWFSHMFAFLN*FEMRQSNKKEINVLYFFFSLSK 307 F ++F+Y RTPL N + +FA + F++RQ +K I F S ++ Sbjct: 64 FAIIAFSYLRTPLSSANELIINKVFAIDHNFQLRQDSKSSITTQQFDLSTAE 115 >AE014298-298|AAF45696.1| 850|Drosophila melanogaster CG3573-PA protein. Length = 850 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +2 Query: 152 FGRLSFTYSRTPLIKKNHDWFSHMFAFLN*FEMRQSNKKEINVLYFFFSLSK 307 F ++F+Y RTPL N + +FA + F++RQ +K I F S ++ Sbjct: 64 FAIIAFSYLRTPLSSANELIINKVFAIDHNFQLRQDSKSSITTQQFDLSTAE 115 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,590,624 Number of Sequences: 53049 Number of extensions: 553870 Number of successful extensions: 1236 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1236 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3190721655 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -