BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0367 (816 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 3.7 U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. 24 4.9 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 6.4 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 6.4 AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 23 8.5 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 78 QIAFSPNNNEVHIYKKEGNDWKQTN 152 QI F NN + IY++ G W + + Sbjct: 36 QIIFVRNNRALLIYERMGGSWSEVH 60 >U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. Length = 280 Score = 24.2 bits (50), Expect = 4.9 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -1 Query: 162 PQGCLFASSHFLPSCICELHYCLVRMQFDFY 70 P + AS PS IC HY R Q Y Sbjct: 184 PPLAVSASITLFPSDICRSHYAASREQVSLY 214 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 6.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 738 ALPFSTVGYVELSCRGRPQATLFPSAEKETL 646 ALP V S RP T FP+ KE + Sbjct: 514 ALPLEQTTPVPTSTTSRPLRTPFPTVRKEDI 544 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.8 bits (49), Expect = 6.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 738 ALPFSTVGYVELSCRGRPQATLFPSAEKETL 646 ALP V S RP T FP+ KE + Sbjct: 513 ALPLEQTTPVPTSTTSRPLRTPFPTVRKEDI 543 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 23.4 bits (48), Expect = 8.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 141 SSHFLPSCICELHYCL 94 SS+ LP +LHYC+ Sbjct: 59 SSYVLPKLYAKLHYCV 74 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 934,149 Number of Sequences: 2352 Number of extensions: 21608 Number of successful extensions: 35 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86487024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -