BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0362 (608 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 23 2.0 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 8.1 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 8.1 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 21 8.1 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 498 LLFLVNFKCT*M*SNSMYTVCYNLIDCNAVLKT 400 LLF V + + NS YT Y+ +D + ++K+ Sbjct: 7 LLFFVIAIASSLAENSKYTTKYDNVDLDEIIKS 39 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 171 KFTFQNINRKLKRNITLVSE 230 K FQN KLK+ I + E Sbjct: 268 KIWFQNRRMKLKKEIQAIKE 287 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.0 bits (42), Expect = 8.1 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +3 Query: 129 ELIDMLHFFHKHLQKFTFQNINRKLKRNITLVSEFYCIMLV 251 EL + +F +HL KF+ N + I V C L+ Sbjct: 305 ELYEFSNFVSQHLPKFSAANFFDIERSTILSVLGTACTFLI 345 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 171 KFTFQNINRKLKRNITLVSE 230 K FQN KLK+ I + E Sbjct: 50 KIWFQNRRMKLKKEIQAIKE 69 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,118 Number of Sequences: 336 Number of extensions: 2229 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -