BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0362 (608 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12C2.12c |glo1|SPBC21D10.03c|glyoxalase I |Schizosaccharomyc... 25 6.5 >SPBC12C2.12c |glo1|SPBC21D10.03c|glyoxalase I |Schizosaccharomyces pombe|chr 2|||Manual Length = 302 Score = 25.4 bits (53), Expect = 6.5 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +1 Query: 256 TKTSVCXLIVLQLQAEDVTNHSDYFNEHTYFTL*FLXQIIFSNNEFSLSF 405 T S L ++ +D+ ++ E F + + Q +F NEFSLSF Sbjct: 5 TDMSTYKLNHTMIRVKDLDKSLKFYTE--VFGMKLIDQWVFEENEFSLSF 52 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,940,672 Number of Sequences: 5004 Number of extensions: 32996 Number of successful extensions: 56 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -