BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0362 (608 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0211 + 21305535-21305895,21306512-21306761,21307543-213076... 29 3.8 >11_06_0211 + 21305535-21305895,21306512-21306761,21307543-21307652, 21308836-21309067,21310233-21310603,21311434-21311507, 21311727-21311880,21312251-21312434,21313066-21313291, 21313704-21314135,21314399-21314456,21314748-21314829, 21315350-21315421,21316594-21316737,21317379-21317457, 21318023-21318105,21318198-21318252,21318488-21318778 Length = 1085 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +1 Query: 322 DYFNEHTYFTL*FLXQIIFSNNEFSLSFKHCITINQIVTNCVHTVTSH 465 +YF H YF L + I+F + L++K +N ++ +SH Sbjct: 154 EYFLLHVYFLLDGIYSIMFRKSTGKLTYKEVTILNNVINLYKEDQSSH 201 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,485,074 Number of Sequences: 37544 Number of extensions: 152949 Number of successful extensions: 203 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 203 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -