BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0361 (826 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC215.07c |||PWWP domain protein|Schizosaccharomyces pombe|chr... 26 7.5 SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos... 25 9.9 >SPBC215.07c |||PWWP domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 25.8 bits (54), Expect = 7.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 172 SYVPFRSVRTRVGRVWWWPSSIASTAPARPALWRRSRP 59 +Y P V T++ WWPS + T ++ R+S+P Sbjct: 122 NYKPGMRVLTKMSGFPWWPSMVV-TESKMTSVARKSKP 158 >SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 25.4 bits (53), Expect = 9.9 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +3 Query: 42 NLGYSPGRDRRHSAGRAGAVDAMEDGHHHTRPTRVRTLRKGTYDGQMGY 188 +L YSP R+H G + ++ T++R + TYD + G+ Sbjct: 78 DLDYSPSVKRKHVNGEGAEKGDHDTSNNGPSITKLRRKVRRTYDTKDGF 126 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,028,593 Number of Sequences: 5004 Number of extensions: 57939 Number of successful extensions: 97 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 404442380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -