BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0356 (810 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0466 + 29278009-29278575 33 0.27 03_06_0290 + 32878040-32880193,32881607-32881720 28 7.6 >02_05_0466 + 29278009-29278575 Length = 188 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 566 QHQHHYQSQFHNHPGHYRQSACHLPLGYRF 477 QHQH + Q H P H+ Q +P G+R+ Sbjct: 137 QHQHQHHPQQHGMPQHHPQHGMPMPPGFRY 166 >03_06_0290 + 32878040-32880193,32881607-32881720 Length = 755 Score = 28.3 bits (60), Expect = 7.6 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 207 IQDHLQFLHQKFPRGSRNRHNWKSMLCQFCS 115 +QD + +L + RG N +W ++ QFC+ Sbjct: 391 VQDSVNYLTELHSRGLVNCQSWNIVIAQFCN 421 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,819,950 Number of Sequences: 37544 Number of extensions: 373911 Number of successful extensions: 906 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 901 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2209429392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -