BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0354 (469 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35812| Best HMM Match : Atrophin-1 (HMM E-Value=0.23) 27 5.9 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_35812| Best HMM Match : Atrophin-1 (HMM E-Value=0.23) Length = 4240 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = -3 Query: 290 SVIWARFRTDV*QCQTDSLQLLKPYRQQQLLDDLCR*GQRRTIHRRDSSGSIRIR 126 SV W + R + Q + + RQ+++ + + R RRT+ R S G I++R Sbjct: 3272 SVGWRKVRRAIDQGKFREYMRSEQIRQRRIAEFMFRRSHRRTVCRARSIGWIKVR 3326 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = -3 Query: 290 SVIWARFRTDV*QCQTDSLQLLKPYRQQQLLDDLCR*GQRRTIHRRDSSGSIRIR 126 SV W + R + Q + + RQ+++ + + R RRT+ R S G I++R Sbjct: 3836 SVGWKKVRRAIDQGKFREYMRSEQIRQRRIAEFVFRRSHRRTVCRARSIGWIKVR 3890 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 439 GARFEPEPPRIWQLSQPCSV 380 G P PP IW L +PC V Sbjct: 70 GCIVPPPPPNIWDLLRPCIV 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,165,154 Number of Sequences: 59808 Number of extensions: 255096 Number of successful extensions: 630 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 969807871 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -