BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0353 (610 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 24 3.3 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 3.3 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 24 3.3 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 4.4 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 24 4.4 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 24 4.4 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 24 4.4 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 24 4.4 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 24 4.4 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 24 4.4 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 170 PLPGPSTSARVW-SITSTTLTNFP 102 P P P+T+ VW T+TT T+ P Sbjct: 210 PPPPPTTTTTVWIDPTATTTTHVP 233 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 170 PLPGPSTSARVW-SITSTTLTNFP 102 P P P+T+ VW T+TT T+ P Sbjct: 211 PPPPPTTTTTVWIDPTATTTTHVP 234 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 170 PLPGPSTSARVW-SITSTTLTNFP 102 P P P+T+ VW T+TT T+ P Sbjct: 211 PPPPPTTTTTVWIDPTATTTTHVP 234 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 170 PLPGPSTSARVW-SITSTTLTNFP 102 P P P+T+ VW T+TT T+ P Sbjct: 211 PPPPPTTTTTVWIDPTATTTTHAP 234 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 170 PLPGPSTSARVW-SITSTTLTNFP 102 P P P+T+ VW T+TT T+ P Sbjct: 211 PPPPPTTTTTVWIDPTATTTTHAP 234 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 170 PLPGPSTSARVW-SITSTTLTNFP 102 P P P+T+ VW T+TT T+ P Sbjct: 211 PPPPPTTTTTVWIDPTATTTTHAP 234 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 170 PLPGPSTSARVW-SITSTTLTNFP 102 P P P+T+ VW T+TT T+ P Sbjct: 210 PPPPPTTTTTVWIDPTATTTTHAP 233 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -3 Query: 269 PRFPHRRVGAVNAYLRRNFVRWSWFKRICCLGTPLPG 159 P FPH +G L + + + +K++ G P G Sbjct: 34 PSFPHGNLGGFGKKLHMSAILQNCYKQLKSSGQPFGG 70 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 170 PLPGPSTSARVW-SITSTTLTNFP 102 P P P+T+ VW T+TT T+ P Sbjct: 211 PPPPPTTTTTVWIDPTATTTTHAP 234 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.8 bits (49), Expect = 4.4 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 64 PGRVALVADGPLKGKLVSVVDVIDQTRA 147 P R A V GPL G+ VSV V + R+ Sbjct: 1037 PTRAAAVDAGPLDGEQVSVDGVAELFRS 1064 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 625,392 Number of Sequences: 2352 Number of extensions: 12512 Number of successful extensions: 27 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -