BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0345 (618 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0633 + 20120560-20123464,20123608-20123672 31 0.97 03_02_0910 + 12317493-12317960,12319678-12319734,12320592-123206... 31 0.97 03_02_0488 - 8824980-8825267,8825364-8827775 30 1.3 03_03_0193 - 15312568-15312753,15312811-15312933,15313112-153131... 30 1.7 03_06_0340 + 33252677-33252864,33253086-33254442,33254565-332546... 28 6.8 02_02_0461 + 10534733-10536302,10536347-10536396,10536845-10538227 28 6.8 >07_03_0633 + 20120560-20123464,20123608-20123672 Length = 989 Score = 30.7 bits (66), Expect = 0.97 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -3 Query: 388 LLRGWSLASMDNSNTAAKPEILSYFA*RRNENLMCRVVGGALS 260 LLRGW S S T + +I+ FA + ENL + V S Sbjct: 211 LLRGWVFTSRSCSRTGLEQDIIESFASEQEENLQRKSVSSESS 253 >03_02_0910 + 12317493-12317960,12319678-12319734,12320592-12320666, 12321219-12321299,12321472-12321546,12321818-12321862, 12321975-12322064,12322153-12322254,12322366-12322420, 12324966-12325027,12325521-12325555,12325877-12326115, 12326219-12328035 Length = 1066 Score = 30.7 bits (66), Expect = 0.97 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -1 Query: 153 ICSSSNAPFAPASVPVARAIPCSSNVFSKIAPTNQLPCPRP 31 +CS + P PA P P N+ K APT + PCP P Sbjct: 1 MCSCARFPH-PALQPAPAPAPPPPNLKPKPAPTTRGPCPSP 40 >03_02_0488 - 8824980-8825267,8825364-8827775 Length = 899 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 168 HTIRRCYEVERAYPFKQFIFSENEHLPSTHE 260 H RCY+ E+ + ++F+ +E LPS+ E Sbjct: 636 HRKSRCYQAEKNHLHREFVLVGSEQLPSSEE 666 >03_03_0193 - 15312568-15312753,15312811-15312933,15313112-15313134, 15313196-15313349,15314443-15314754 Length = 265 Score = 29.9 bits (64), Expect = 1.7 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Frame = +3 Query: 159 PCPHTIRRCYEVERAY-P-FKQFIFSENEHLPSTHEDKAPPTTRHMRFSFLLQAKYERIS 332 PC TIR Y P +K +I SE + D A + + FLL +++ S Sbjct: 177 PCSFTIRGFLRAVPTYLPLWKLYIVSEKPLTTTRPRDYAQILIQEIE-KFLLDLRFKYRS 235 Query: 333 GLAAVLLLSMDASDQPLSNPRADQF 407 + ++ +++ D ++ LS +AD+F Sbjct: 236 RIRSLYIVTTDINEHILSIMKADEF 260 >03_06_0340 + 33252677-33252864,33253086-33254442,33254565-33254667, 33256081-33256171,33257208-33257300,33258316-33258471, 33258583-33258655 Length = 686 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -1 Query: 372 HWRPWTTAIPQLSRRFFHTSLEEGMKT 292 HW+P + + RFFH+SL++ M+T Sbjct: 568 HWQPNRQQLTEF--RFFHSSLQQSMET 592 >02_02_0461 + 10534733-10536302,10536347-10536396,10536845-10538227 Length = 1000 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +3 Query: 81 LKSMEWHVRLGRTQVQTARYLMNIWLPCPHTIRRCYEVERAYPFKQFIFSEN 236 LKS W ++ T++ A L ++LP H ++RC+ YP K F E+ Sbjct: 434 LKSELWELKQNNTEILPALRLSYLYLP-TH-LKRCFSFCAVYP-KDHKFEED 482 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,283,080 Number of Sequences: 37544 Number of extensions: 397225 Number of successful extensions: 1055 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1018 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1055 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -