BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0345 (618 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 25 1.5 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 25 2.6 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 25.4 bits (53), Expect = 1.5 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 248 FNTRG*SAAHHATHEVFIPSSSEV*KNLRLSCGIAVV 358 + T G +A HH T VF+ S ++R S G+ V Sbjct: 163 YGTTGGNATHHRTTGVFVTRHSTTGSSVRPSKGLIPV 199 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 24.6 bits (51), Expect = 2.6 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -1 Query: 327 FFHTSLEEGMKTSCVAWWAALYPRVLKADVHF 232 F+ + ++G+ CVA W LY L + F Sbjct: 511 FYLSDFKDGLSMQCVASWIFLYFACLSPIITF 542 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 710,748 Number of Sequences: 2352 Number of extensions: 14442 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -