BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0345 (618 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81066-6|CAN99668.1| 127|Caenorhabditis elegans Hypothetical pr... 33 0.12 AF016682-6|AAL06054.1| 284|Caenorhabditis elegans Hypothetical ... 29 2.7 Z49072-1|CAA88884.1| 938|Caenorhabditis elegans Hypothetical pr... 27 8.1 U58748-10|AAB52970.2| 701|Caenorhabditis elegans Hypothetical p... 27 8.1 >Z81066-6|CAN99668.1| 127|Caenorhabditis elegans Hypothetical protein F17B5.8 protein. Length = 127 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = -1 Query: 147 SSSNAPFAPASVPVARAIPCSSNVFSKIAPTNQLPCPRPYISSSTVDNF 1 S+S F+ + RA P +SN+ SK A TN+ PR +++ + F Sbjct: 54 STSADKFSIGDIDFLRATPVNSNIVSKFAATNESSTPRIFVTEKNNNLF 102 >AF016682-6|AAL06054.1| 284|Caenorhabditis elegans Hypothetical protein T07D3.3 protein. Length = 284 Score = 29.1 bits (62), Expect = 2.7 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 429 TVFLLPPETDQHVDYLEV 376 T+F++PP +D+H DY V Sbjct: 90 TMFVIPPSSDEHTDYYNV 107 >Z49072-1|CAA88884.1| 938|Caenorhabditis elegans Hypothetical protein T24A11.1a protein. Length = 938 Score = 27.5 bits (58), Expect = 8.1 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -1 Query: 144 SSNAPFAPASVPVARAIPCSSNVFSKIAPTNQLPCPRPYISSS 16 SS F P+S P + S N+ + ++PT P P SSS Sbjct: 872 SSFDSFGPSSPPASSTSSSSLNMLASMSPTRPQPIPISCKSSS 914 >U58748-10|AAB52970.2| 701|Caenorhabditis elegans Hypothetical protein ZK180.6 protein. Length = 701 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +2 Query: 239 TSAFNTRG*SAAHHATHEVFIPSSS 313 +S+ ++ SA HH TH+V +PS+S Sbjct: 228 SSSSSSSSASAEHHPTHQVRVPSAS 252 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,544,245 Number of Sequences: 27780 Number of extensions: 341757 Number of successful extensions: 848 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 847 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -