BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0341 (822 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C... 31 0.70 At5g57050.1 68418.m07121 protein phosphatase 2C ABI2 / PP2C ABI2... 31 1.2 At4g26080.1 68417.m03755 protein phosphatase 2C ABI1 / PP2C ABI1... 31 1.2 At1g43900.1 68414.m05065 protein phosphatase 2C, putative / PP2C... 31 1.2 At5g63700.1 68418.m07996 zinc finger (C3HC4 type RING finger) fa... 30 1.6 At2g30020.1 68415.m03652 protein phosphatase 2C, putative / PP2C... 30 1.6 At5g51760.1 68418.m06418 protein phosphatase 2C, putative / PP2C... 30 2.1 At5g13240.1 68418.m01521 expressed protein prdeicted proteins, S... 29 2.8 At3g55050.2 68416.m06114 serine/threonine protein phosphatase 2C... 29 2.8 At3g55050.1 68416.m06113 serine/threonine protein phosphatase 2C... 29 2.8 At3g51370.1 68416.m05626 protein phosphatase 2C, putative / PP2C... 29 2.8 At3g17250.1 68416.m02205 protein phosphatase 2C-related / PP2C-r... 29 2.8 At1g67820.1 68414.m07741 protein phosphatase 2C, putative / PP2C... 29 2.8 At1g17550.1 68414.m02161 protein phosphatase 2C-related / PP2C-r... 29 2.8 At1g07160.1 68414.m00762 protein phosphatase 2C, putative / PP2C... 29 2.8 At3g43920.1 68416.m04701 ribonuclease III family protein similar... 29 3.7 At2g25070.1 68415.m02999 protein phosphatase 2C, putative / PP2C... 29 3.7 At5g66080.1 68418.m08325 protein phosphatase 2C family protein /... 29 4.9 At5g06750.1 68418.m00763 protein phosphatase 2C family protein /... 29 4.9 At5g02760.1 68418.m00218 protein phosphatase 2C family protein /... 29 4.9 At4g38520.2 68417.m05451 protein phosphatase 2C family protein /... 29 4.9 At4g38520.1 68417.m05450 protein phosphatase 2C family protein /... 29 4.9 At1g48040.1 68414.m05354 protein phosphatase 2C-related / PP2C-r... 29 4.9 At3g17090.1 68416.m02180 protein phosphatase 2C family protein /... 28 6.5 At3g12620.1 68416.m01571 protein phosphatase 2C family protein /... 28 6.5 At2g33700.1 68415.m04130 protein phosphatase 2C, putative / PP2C... 28 6.5 At1g72770.1 68414.m08414 protein phosphatase 2C P2C-HA / PP2C P2... 28 6.5 At3g11385.1 68416.m01386 DC1 domain-containing protein contains ... 28 8.6 >At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putative contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] Length = 390 Score = 31.5 bits (68), Expect = 0.70 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 265 DERDLEYAFFGIYDGHGGSE 324 D+ + AFFG++DGHGGS+ Sbjct: 153 DDGGYKNAFFGVFDGHGGSK 172 >At5g57050.1 68418.m07121 protein phosphatase 2C ABI2 / PP2C ABI2 / abscisic acid-insensitive 2 (ABI2) identical to SP|O04719 Protein phosphatase 2C ABI2 (EC 3.1.3.16) (PP2C) (Abscisic acid- insensitive 2) {Arabidopsis thaliana} Length = 423 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = +1 Query: 289 FFGIYDGHGGSE 324 FFG+YDGHGGS+ Sbjct: 160 FFGVYDGHGGSQ 171 >At4g26080.1 68417.m03755 protein phosphatase 2C ABI1 / PP2C ABI1 / abscisic acid-insensitive 1 (ABI1) nearly identical to SP|P49597 Protein phosphatase 2C ABI1 (EC 3.1.3.16) (PP2C) (Abscisic acid- insensitive 1) {Arabidopsis thaliana} Length = 434 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = +1 Query: 289 FFGIYDGHGGSE 324 FFG+YDGHGGS+ Sbjct: 172 FFGVYDGHGGSQ 183 >At1g43900.1 68414.m05065 protein phosphatase 2C, putative / PP2C, putative similar to protein phosphatase type 2C GI:4336436 from [Lotus japonicus] Length = 371 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 286 AFFGIYDGHGGSEXQRSPKNT*WIQL*NSDN 378 AFFG++DGHGG+ KN + L + D+ Sbjct: 153 AFFGVFDGHGGARTAEYLKNNLFKNLVSHDD 183 >At5g63700.1 68418.m07996 zinc finger (C3HC4 type RING finger) family protein contains Pfam PF03126: Plus-3 domain; contains Pfam PF02201: BAF60b domain of the SWIB complex; contains Pfam PF00628: PHD-finger domain; contains Prosite Zinc finger, C3HC4 type (RING finger), signature; similar to CPRF interacting protein (GI:9588690) [Petroselinum crispum] Length = 571 Score = 30.3 bits (65), Expect = 1.6 Identities = 24/98 (24%), Positives = 48/98 (48%), Gaps = 5/98 (5%) Frame = -2 Query: 293 KKAYSKSRSSSVCDKQRKTNLPCT-FSRLGYNAPSRVN*RRLTLAFYNTQHLNFQWKNIC 117 KK ++S +C+K+ + + T F+ + + V R+ + Q+ +F K + Sbjct: 374 KKQKTESSDDEICEKEVQPEMRATGFATINADNLKLVYLRKSLVLELLKQNDSFVDKVVG 433 Query: 116 DFIVTKT----FLSYSFCILQLREFRRSDDRSRGLIDH 15 F+ K F++Y ILQ+ + +DD+S G++ H Sbjct: 434 SFVKVKNGPRDFMAYQ--ILQVTGIKNADDQSEGVLLH 469 >At2g30020.1 68415.m03652 protein phosphatase 2C, putative / PP2C, putative similar to protein phosphatase 2C (GI:4587992){Arabidopsis thaliana} Length = 396 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +1 Query: 211 RREKVHGRFVFRCLSQTEDERDLEYAFFGIYDGHGG 318 RRE + RF + T D + A FG+YDGHGG Sbjct: 148 RREAMEDRFS----AITNLHGDRKQAIFGVYDGHGG 179 >At5g51760.1 68418.m06418 protein phosphatase 2C, putative / PP2C, putative contains PF00481: Protein phosphatase 2C domain; similar to protein phosphatase 2C (GI:10432446) [Nicotiana tabacum] Length = 416 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 250 LSQTEDERDLEYAFFGIYDGHGGSE 324 L + E R FF +YDGHGGS+ Sbjct: 131 LCKPEVNRQRPVHFFAVYDGHGGSQ 155 >At5g13240.1 68418.m01521 expressed protein prdeicted proteins, Schizosaccharomyces pombe Length = 224 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 357 SIVKQRQFWSDNDEDVLKAIRNGYMLTHLNMWKE 458 S VK QF+S+ D K I N YM W E Sbjct: 97 SAVKAHQFFSEESWDTFKQIFNNYMFEASKEWTE 130 >At3g55050.2 68416.m06114 serine/threonine protein phosphatase 2C (PP2C6) identical to Ser/Thr protein phosphatase 2C (PP2C6) (GI:15020818) [Arabidopsis thaliana]; similar to protein phosphatase 2C (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain; contains TIGRFAM TIGR01573 : CRISPR-associated protein Cas2 Length = 384 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 Query: 280 EYAFFGIYDGHGGSEXQR 333 E F G+YDGHGG E R Sbjct: 81 EATFVGVYDGHGGPEAAR 98 >At3g55050.1 68416.m06113 serine/threonine protein phosphatase 2C (PP2C6) identical to Ser/Thr protein phosphatase 2C (PP2C6) (GI:15020818) [Arabidopsis thaliana]; similar to protein phosphatase 2C (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain; contains TIGRFAM TIGR01573 : CRISPR-associated protein Cas2 Length = 384 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 Query: 280 EYAFFGIYDGHGGSEXQR 333 E F G+YDGHGG E R Sbjct: 81 EATFVGVYDGHGGPEAAR 98 >At3g51370.1 68416.m05626 protein phosphatase 2C, putative / PP2C, putative similar to Ser/Thr protein phosphatase 2C (PP2C6) (GI:15020818) [Arabidopsis thaliana]; similar to protein phosphatase 2C (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain Length = 379 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 289 FFGIYDGHGGSEXQR 333 F GIYDGHGG E R Sbjct: 79 FIGIYDGHGGPETSR 93 >At3g17250.1 68416.m02205 protein phosphatase 2C-related / PP2C-related similar to protein phosphatase-2C GB:AAC36698 from [Mesembryanthemum crystallinum] Length = 422 Score = 29.5 bits (63), Expect = 2.8 Identities = 9/13 (69%), Positives = 13/13 (100%) Frame = +1 Query: 286 AFFGIYDGHGGSE 324 AF+G++DGHGGS+ Sbjct: 157 AFYGVFDGHGGSD 169 >At1g67820.1 68414.m07741 protein phosphatase 2C, putative / PP2C, putative similar to protein phosphatase 2C emb|CAA72341.1 Length = 445 Score = 29.5 bits (63), Expect = 2.8 Identities = 9/13 (69%), Positives = 13/13 (100%) Frame = +1 Query: 286 AFFGIYDGHGGSE 324 +FFG+YDGHGG++ Sbjct: 150 SFFGVYDGHGGAK 162 >At1g17550.1 68414.m02161 protein phosphatase 2C-related / PP2C-related similar to protein phosphatase 2C GI:3242077 from (Arabidopsis thaliana) Length = 511 Score = 29.5 bits (63), Expect = 2.8 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = +1 Query: 289 FFGIYDGHGGSE 324 FFG+YDGHGG++ Sbjct: 237 FFGVYDGHGGAQ 248 >At1g07160.1 68414.m00762 protein phosphatase 2C, putative / PP2C, putative similar to protein phosphatase 2C GI:2582800 from [Medicago sativa] Length = 380 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 211 RREKVHGRFVFRCLSQTEDERDLEYAFFGIYDGHGG 318 +RE + RF + T + D + A FG+YDGHGG Sbjct: 131 KREAMEDRFS----AITNLQGDPKQAIFGVYDGHGG 162 >At3g43920.1 68416.m04701 ribonuclease III family protein similar to RNA helicase/RNAseIII CAF protein [Arabidopsis thaliana] GI:6102610; contains Pfam profiles PF02170: PAZ domain, PF00636: RNase3 domain Length = 1531 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 529 NKSHTGCVPAVLGKPVTVLGHFSSSFHMFKWVSI 428 +KS + C A++G V G S+S HM KW+ I Sbjct: 1089 SKSVSDCAEALIGA-YYVSGGLSASLHMMKWLGI 1121 >At2g25070.1 68415.m02999 protein phosphatase 2C, putative / PP2C, putative Length = 355 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 274 DLEYAFFGIYDGHGG 318 D + +FFG+YDGHGG Sbjct: 47 DDKTSFFGVYDGHGG 61 >At5g66080.1 68418.m08325 protein phosphatase 2C family protein / PP2C family protein similar to Ser/Thr protein phosphatase 2C (PP2C6) (GI:15020818) [Arabidopsis thaliana]; similar to protein phosphatase 2C (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain Length = 385 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 289 FFGIYDGHGGSEXQR 333 F G+YDGHGG E R Sbjct: 82 FVGVYDGHGGPETSR 96 >At5g06750.1 68418.m00763 protein phosphatase 2C family protein / PP2C family protein similar to Ser/Thr protein phosphatase 2C (PP2C6) (GI:15020818) [Arabidopsis thaliana]; similar to protein phosphatase 2C (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain; Length = 393 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 289 FFGIYDGHGGSEXQR 333 F G+YDGHGG E R Sbjct: 82 FVGVYDGHGGPEASR 96 >At5g02760.1 68418.m00218 protein phosphatase 2C family protein / PP2C family protein similar to Ser/Thr protein phosphatase 2C (PP2C6) (GI:15020818) [Arabidopsis thaliana]; similar to protein phosphatase 2C (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain Length = 370 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 289 FFGIYDGHGGSEXQR 333 F G+YDGHGG E R Sbjct: 72 FVGVYDGHGGPEASR 86 >At4g38520.2 68417.m05451 protein phosphatase 2C family protein / PP2C family protein similar to Ser/Thr protein phosphatase 2C (PP2C6) (GI:15020818) [Arabidopsis thaliana]; similar to protein phosphatase 2C (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain; Length = 400 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 289 FFGIYDGHGGSEXQR 333 F G+YDGHGG E R Sbjct: 81 FVGVYDGHGGPETSR 95 >At4g38520.1 68417.m05450 protein phosphatase 2C family protein / PP2C family protein similar to Ser/Thr protein phosphatase 2C (PP2C6) (GI:15020818) [Arabidopsis thaliana]; similar to protein phosphatase 2C (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain; Length = 400 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 289 FFGIYDGHGGSEXQR 333 F G+YDGHGG E R Sbjct: 81 FVGVYDGHGGPETSR 95 >At1g48040.1 68414.m05354 protein phosphatase 2C-related / PP2C-related similar to protein phosphatase-2C GB:AAC36698 GI:3643085 from [Mesembryanthemum crystallinum] Length = 377 Score = 28.7 bits (61), Expect = 4.9 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +1 Query: 286 AFFGIYDGHGGSE 324 AF+G++DGHGG E Sbjct: 109 AFYGVFDGHGGPE 121 >At3g17090.1 68416.m02180 protein phosphatase 2C family protein / PP2C family protein similar to Ser/Thr protein phosphatase 2C (PP2C6) (GI:15020818) [Arabidopsis thaliana]; similar to protein phosphatase 2C (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain; Length = 384 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 289 FFGIYDGHGGSEXQR 333 F G+YDGHGG E R Sbjct: 84 FVGVYDGHGGPEAAR 98 >At3g12620.1 68416.m01571 protein phosphatase 2C family protein / PP2C family protein similar to Ser/Thr protein phosphatase 2C (PP2C6) (GI:15020818) [Arabidopsis thaliana]; similar to protein phosphatase 2C (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain; Length = 385 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 289 FFGIYDGHGGSEXQR 333 F G+YDGHGG E R Sbjct: 83 FVGVYDGHGGPEAAR 97 >At2g33700.1 68415.m04130 protein phosphatase 2C, putative / PP2C, putative contains PF00481: Protein phosphatase 2C domain; similar to protein phosphatase-2C (PP2C) (GI:3643085) [Mesembryanthemum crystallinum] Length = 380 Score = 28.3 bits (60), Expect = 6.5 Identities = 8/13 (61%), Positives = 13/13 (100%) Frame = +1 Query: 286 AFFGIYDGHGGSE 324 AF+G++DGHGG++ Sbjct: 122 AFYGVFDGHGGTD 134 >At1g72770.1 68414.m08414 protein phosphatase 2C P2C-HA / PP2C P2C-HA (P2C-HA) identical to protein phosphatase 2C (AtP2C-HA) GB:AJ003119 [Arabidopsis thaliana] (Plant Mol. Biol. 38 (5), 879-883 (1998)) Length = 511 Score = 28.3 bits (60), Expect = 6.5 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 289 FFGIYDGHGG 318 FFG+YDGHGG Sbjct: 238 FFGVYDGHGG 247 >At3g11385.1 68416.m01386 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 766 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = -2 Query: 179 RRLTLAFYNTQHLNFQWKNICDFIVTKTFLSYSFCILQLREFRRSDDRSRGLIDHDAC 6 R+LT ++ L F ++N I + + SFC + SD + G + D C Sbjct: 238 RKLTHPYHLQHPLTFTFRNDETGITSDGIIDESFCTTVFSDSNTSDPKKLGSTESDHC 295 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,109,314 Number of Sequences: 28952 Number of extensions: 353541 Number of successful extensions: 1022 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1022 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1882599200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -