BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0340 (597 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 4.3 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 5.7 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 7.5 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.8 bits (49), Expect = 4.3 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -1 Query: 597 GASNSLLRLSSHEYFRERCRISRH-RGQGVSTPSTK-PNTIILPRRG 463 G N+ ++++ EY E CR+ + +G P K ++LP+ G Sbjct: 510 GIPNAAVKVAIEEYTEEFCRLYQDCLSRGTFPPQWKRQRLVLLPKPG 556 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 5.7 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 328 PVEXXGAPAAGRCHRGGGSAPRAGLSGRRGRAHATRDHPRQAADRTSPRQNDG 486 P G G GGGS+ G G G RDH DR R+ G Sbjct: 200 PGAGGGGSGGGAPGGGGGSSGGPGPGGGGGGGGRDRDH----RDRDREREGGG 248 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 411 PRTRSRHSGPSSPSCR 458 PR RS SG PSCR Sbjct: 257 PRRRSPRSGGRWPSCR 272 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 573,727 Number of Sequences: 2352 Number of extensions: 10065 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -