BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0339 (648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21090.1 68416.m02666 ABC transporter family protein similar ... 28 4.7 At1g51500.1 68414.m05796 ABC transporter family protein similar ... 28 4.7 At5g09850.1 68418.m01139 transcription elongation factor-related... 28 6.1 At1g60350.1 68414.m06795 no apical meristem (NAM) protein-relate... 27 8.1 >At3g21090.1 68416.m02666 ABC transporter family protein similar to ATP-binding cassette, sub-family G (WHITE), member 2 GB:NP_036050 from [Mus musculus] Length = 691 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 293 PKVYSVYPAACYSYGQWAAQ 234 PK++ YP + SYG WA Q Sbjct: 546 PKIFWRYPVSYISYGSWAIQ 565 >At1g51500.1 68414.m05796 ABC transporter family protein similar to GB:AAF61569 from [Bombyx mori] Length = 687 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 293 PKVYSVYPAACYSYGQWAAQ 234 PKV+ YP + SYG WA Q Sbjct: 547 PKVFWRYPISFMSYGSWAIQ 566 >At5g09850.1 68418.m01139 transcription elongation factor-related low similarity to SP|P10712 Transcription elongation factor S-II (Transcription elongation factor A) {Mus musculus} Length = 353 Score = 27.9 bits (59), Expect = 6.1 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 627 NDQSPLEQXFHXSXHQQXPGFGSNPI 550 ++ SP+++ H QQ P FG +P+ Sbjct: 216 DEDSPVQKALHNGSRQQVPDFGYSPV 241 >At1g60350.1 68414.m06795 no apical meristem (NAM) protein-related contains Pfam PF02365 : No apical meristem (NAM) protein; similar to CUP-SHAPED COTYLEDON1 (CUC1) (GI:12060422) [Arabidopsis thaliana] Length = 320 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = -3 Query: 175 ITNNICCVNAMMSKGLIDSL----AVCVRGNITSGKPQKCI 65 +TNN+ C++ + L D + C+ N T GK +CI Sbjct: 207 VTNNVYCLHPLELVDLQDRMFNDYGTCIFANKTCGKTDRCI 247 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,291,691 Number of Sequences: 28952 Number of extensions: 299513 Number of successful extensions: 707 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 707 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -