BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0336 (549 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 60 5e-11 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 23 5.0 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 60.1 bits (139), Expect = 5e-11 Identities = 34/58 (58%), Positives = 37/58 (63%) Frame = +2 Query: 347 NAVITVPAYFNDSQXTSHKRCRYHLWLGKRFFRIINEPTAAAIAYGLDKKGTGEEMYL 520 +AVITVPAYFNDSQ + K G RIINEPTAAA+AYGLDK GE L Sbjct: 1 DAVITVPAYFNDSQRQATKDAG--AIAGLNVMRIINEPTAAALAYGLDKNLKGERNVL 56 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 23.4 bits (48), Expect = 5.0 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -3 Query: 478 SNRSSSRFIDDSEETFSKPEMVPASFVACLLRVIEVRGNRDNCILHSF 335 S+ SS SEE ++ PA + +E RGNR+ L++F Sbjct: 380 SSSSSDSSSSSSEEEAENFKISPAEQYKKQAKEVERRGNRNRRDLNAF 427 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 574,382 Number of Sequences: 2352 Number of extensions: 11430 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -