BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0334 (461 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70... 85 2e-17 At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70... 83 1e-16 At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HS... 82 2e-16 At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2 (HS... 81 3e-16 At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3 (HS... 81 4e-16 At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein, puta... 69 2e-12 At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)... 69 2e-12 At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)... 68 3e-12 At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)... 68 3e-12 At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)... 68 3e-12 At1g79930.1 68414.m09340 heat shock protein, putative contains P... 41 4e-04 At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70... 35 0.023 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 34 0.041 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 32 0.22 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 31 0.29 At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-asso... 31 0.38 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 31 0.38 At1g79350.1 68414.m09247 DNA-binding protein, putative contains ... 31 0.38 At1g11660.1 68414.m01339 heat shock protein, putative strong sim... 30 0.66 At5g01570.1 68418.m00072 hypothetical protein hypothetical prote... 30 0.88 At5g52530.2 68418.m06518 dentin sialophosphoprotein-related cont... 29 1.2 At5g52530.1 68418.m06517 dentin sialophosphoprotein-related cont... 29 1.2 At5g24880.1 68418.m02946 expressed protein ; expression supporte... 29 1.2 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 29 1.2 At5g16730.1 68418.m01959 expressed protein weak similarity to mi... 29 2.0 At4g09950.1 68417.m01628 avirulence-responsive family protein / ... 29 2.0 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 29 2.0 At5g17890.1 68418.m02098 LIM domain-containing protein / disease... 28 2.7 At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family... 28 2.7 At1g53250.1 68414.m06034 expressed protein 28 2.7 At5g27230.1 68418.m03248 expressed protein ; expression support... 28 3.5 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 28 3.5 At3g48580.1 68416.m05304 xyloglucan:xyloglucosyl transferase, pu... 28 3.5 At3g29410.1 68416.m03695 terpene synthase/cyclase family protein... 28 3.5 At1g44910.1 68414.m05146 FF domain-containing protein / WW domai... 28 3.5 At5g60030.1 68418.m07527 expressed protein 27 4.7 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 27 4.7 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 27 4.7 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 27 4.7 At1g63770.2 68414.m07216 peptidase M1 family protein similar to ... 27 4.7 At1g63770.1 68414.m07217 peptidase M1 family protein similar to ... 27 4.7 At1g61080.1 68414.m06877 proline-rich family protein 27 4.7 At1g34350.1 68414.m04264 expressed protein 27 4.7 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 27 4.7 At5g55070.1 68418.m06864 2-oxoacid dehydrogenase family protein ... 27 6.2 At5g08480.2 68418.m01002 VQ motif-containing protein contains PF... 27 6.2 At4g09160.1 68417.m01517 SEC14 cytosolic factor family protein /... 27 6.2 At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 27 6.2 At2g16880.1 68415.m01942 pentatricopeptide (PPR) repeat-containi... 27 6.2 At4g14340.1 68417.m02208 casein kinase I (CKI1) identical to cas... 27 8.2 At4g10740.1 68417.m01754 F-box family protein contains Pfam PF00... 27 8.2 At3g51350.1 68416.m05622 aspartyl protease family protein contai... 27 8.2 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 27 8.2 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 27 8.2 At2g41960.1 68415.m05191 expressed protein 27 8.2 At2g29090.1 68415.m03536 cytochrome P450 family protein similar ... 27 8.2 At2g02870.1 68415.m00237 kelch repeat-containing F-box family pr... 27 8.2 At1g49270.1 68414.m05524 protein kinase family protein contains ... 27 8.2 At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein /... 27 8.2 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 27 8.2 >At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70, putative similar to heat shock protein hsp70 GI:1771478 from [Pisum sativum] Length = 646 Score = 85.0 bits (201), Expect = 2e-17 Identities = 35/68 (51%), Positives = 55/68 (80%) Frame = -3 Query: 459 AKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQK 280 AKN+LE+Y ++M++T++DEKL +K++ DKQ I ++TI+W++ NQLA+ +E+E+K K Sbjct: 543 AKNSLENYAYNMRNTIKDEKLAQKLTQEDKQKIEKAIDETIEWIEGNQLAEVDEFEYKLK 602 Query: 279 ELEGIYNP 256 ELEGI NP Sbjct: 603 ELEGICNP 610 >At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70, putative strong similarity to heat shock protein GI:425194 [Spinacia oleracea] Length = 650 Score = 82.6 bits (195), Expect = 1e-16 Identities = 35/72 (48%), Positives = 53/72 (73%) Frame = -3 Query: 459 AKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQK 280 AKNALE+Y ++M++T++DEK+ K+ +DK+ I D + I+WLD NQLA+ +E+E K K Sbjct: 544 AKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMK 603 Query: 279 ELEGIYNPKLRR 244 ELE + NP + R Sbjct: 604 ELESLCNPIIAR 615 >At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HSC70-1) (HSP70-1) identical to SP|P22953 Heat shock cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis thaliana} Length = 651 Score = 82.2 bits (194), Expect = 2e-16 Identities = 35/68 (51%), Positives = 51/68 (75%) Frame = -3 Query: 459 AKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQK 280 AKNALE+Y ++M++T++DEK+ EK+ +DK+ I D I+WL+ NQLA+ +E+E K K Sbjct: 544 AKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMK 603 Query: 279 ELEGIYNP 256 ELE I NP Sbjct: 604 ELESICNP 611 >At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2 (HSC70-2) (HSP70-2) identical to SP|P22954 Heat shock cognate 70 kDa protein 2 (Hsc70.2) {Arabidopsis thaliana} Length = 653 Score = 81.4 bits (192), Expect = 3e-16 Identities = 33/68 (48%), Positives = 50/68 (73%) Frame = -3 Query: 459 AKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQK 280 AKNALE+Y ++M++T+ DEK+ EK+ +DK+ + D + I+WLD NQL + +E+E K K Sbjct: 544 AKNALENYAYNMRNTIRDEKIGEKLPAADKKKVEDSIEEAIQWLDGNQLGEADEFEDKMK 603 Query: 279 ELEGIYNP 256 ELE + NP Sbjct: 604 ELESVCNP 611 >At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3 (HSC70-3) (HSP70-3) identical to SP|O65719 Heat shock cognate 70 kDa protein 3 (Hsc70.3) {Arabidopsis thaliana} Length = 649 Score = 81.0 bits (191), Expect = 4e-16 Identities = 35/68 (51%), Positives = 51/68 (75%) Frame = -3 Query: 459 AKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQK 280 AKNALE+Y ++M++T+ DEK+ EK++ DK+ I D I+WL++NQLA+ +E+E K K Sbjct: 544 AKNALENYAYNMRNTIRDEKIGEKLAGDDKKKIEDSIEAAIEWLEANQLAECDEFEDKMK 603 Query: 279 ELEGIYNP 256 ELE I NP Sbjct: 604 ELESICNP 611 >At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein, putative / HSC70, putative / HSP70, putative strong similarity to heat shock cognate 70 kd protein 1 SP:P22953 [Arabidopsis thaliana (Mouse-ear cress)] Length = 617 Score = 68.5 bits (160), Expect = 2e-12 Identities = 29/67 (43%), Positives = 47/67 (70%) Frame = -3 Query: 459 AKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQK 280 AKN LE+Y +++ +T+ D + EK+ +DK+ D + I+WLD NQLA+ +E+EHK K Sbjct: 544 AKNGLENYAYNVGNTLRD--MGEKLPAADKKKFEDSIEEVIQWLDDNQLAEADEFEHKMK 601 Query: 279 ELEGIYN 259 ELE +++ Sbjct: 602 ELESVWS 608 >At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3) Similar to Arabidopsis luminal binding protein (gb|D89342); contains Pfam domain PF00012: dnaK protein Length = 678 Score = 68.5 bits (160), Expect = 2e-12 Identities = 31/72 (43%), Positives = 51/72 (70%), Gaps = 1/72 (1%) Frame = -3 Query: 459 AKNALESYCFSMKSTMED-EKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQ 283 A+N LE+Y ++MKST+ D EKL +KISD DK+ + + ++WL+ N A+KE+Y+ K Sbjct: 583 ARNKLETYVYNMKSTVADKEKLAKKISDEDKEKMEGVLKEALEWLEENVNAEKEDYDEKL 642 Query: 282 KELEGIYNPKLR 247 KE+E + +P ++ Sbjct: 643 KEVELVCDPVIK 654 >At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2) similar to SWISS-PROT: Q39043; GI:1303695; luminal binding protein (BiP) [Arabidopsis thaliana] Length = 613 Score = 68.1 bits (159), Expect = 3e-12 Identities = 29/69 (42%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = -3 Query: 459 AKNALESYCFSMKSTMED-EKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQ 283 A+NALE+Y ++MK+ + D +KL +K+ +K+ I + ++WLD NQ ++KEEY+ K Sbjct: 514 ARNALETYVYNMKNQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKL 573 Query: 282 KELEGIYNP 256 KE+E + NP Sbjct: 574 KEVEAVCNP 582 >At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2) similar to SWISS-PROT: Q39043; GI:1303695; luminal binding protein (BiP) [Arabidopsis thaliana] Length = 668 Score = 68.1 bits (159), Expect = 3e-12 Identities = 29/69 (42%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = -3 Query: 459 AKNALESYCFSMKSTMED-EKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQ 283 A+NALE+Y ++MK+ + D +KL +K+ +K+ I + ++WLD NQ ++KEEY+ K Sbjct: 569 ARNALETYVYNMKNQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKL 628 Query: 282 KELEGIYNP 256 KE+E + NP Sbjct: 629 KEVEAVCNP 637 >At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1) SWISS-PROT:Q9LKR3 PMID:8888624 Length = 669 Score = 68.1 bits (159), Expect = 3e-12 Identities = 29/69 (42%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = -3 Query: 459 AKNALESYCFSMKSTMED-EKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQ 283 A+NALE+Y ++MK+ + D +KL +K+ +K+ I + ++WLD NQ ++KEEY+ K Sbjct: 569 ARNALETYVYNMKNQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKL 628 Query: 282 KELEGIYNP 256 KE+E + NP Sbjct: 629 KEVEAVCNP 637 >At1g79930.1 68414.m09340 heat shock protein, putative contains Pfam profile: PF00012 Heat shock hsp70 proteins; similar to heat-shock proteins GB:CAA94389, GB:AAD55461 [Arabidopsis thaliana] Length = 831 Score = 41.1 bits (92), Expect = 4e-04 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = -3 Query: 456 KNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWL-DSNQLADKEEYEHKQK 280 KNA+ESY + M++ + D K +E I+DS+++ L + WL + + K Y K + Sbjct: 623 KNAVESYVYDMRNKLSD-KYQEYITDSEREAFLANLQEVEDWLYEDGEDETKGVYVAKLE 681 Query: 279 ELEGIYNP 256 EL+ + +P Sbjct: 682 ELKKVGDP 689 >At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70, putative Length = 867 Score = 35.1 bits (77), Expect = 0.023 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 1/68 (1%) Frame = -3 Query: 456 KNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWL-DSNQLADKEEYEHKQK 280 KN LESY ++ K +E + ++ + +++ ++K ++ WL + A+ E+E + Sbjct: 663 KNNLESYIYATKEKLETPEFEKISTQEERKAFVEKLDEVQDWLYMDGEDANATEFEKRLD 722 Query: 279 ELEGIYNP 256 L+ I +P Sbjct: 723 SLKAIGSP 730 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 34.3 bits (75), Expect = 0.041 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 2/86 (2%) Frame = -3 Query: 414 MEDEKLKEKI--SDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPKLRRC 241 M + LKEK+ S +D T+L++C ++W D +Q K++ E +KELE + + Sbjct: 247 MPPKDLKEKLRKSAADLTTVLERCLHRLEW-DRSQEQQKKK-EEDEKELERVQMAMIDWH 304 Query: 240 TRVPEESPEVCRASRAEHPEPEVPPP 163 V ES + A+ + E+PPP Sbjct: 305 DFVVVESIDF-----ADEEDEELPPP 325 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 31.9 bits (69), Expect = 0.22 Identities = 27/109 (24%), Positives = 42/109 (38%), Gaps = 3/109 (2%) Frame = -3 Query: 456 KNALESYCFSMKSTMEDEKLKEKISDSD---KQTILDKCNDTIKWLDSNQLADKEEYEHK 286 +N + S +DE LK K S+++ K+ IL+K + +D + Sbjct: 128 QNFSQKEALSNNGDGDDESLKVKKSETEEKAKEAILEKQDSVKSQIDDKDCSKVSVKSEM 187 Query: 285 QKELEGIYNPKLRRCTRVPEESPEVCRASRAEHPEPEVPPPGLEALAPP 139 + P +P E P A + + P PPPG AL PP Sbjct: 188 VSKSFAPPPPPPPGNAAIPVEPPLTMSAEKESYA-PLPPPPGRAALPPP 235 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 31.5 bits (68), Expect = 0.29 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 240 TRVPEESPEVCRASRAEHPEPEVPPPG-LEALAPPSRRSIKP 118 +R P S + SR P P +PPP L PP+R P Sbjct: 521 SRAPSSSAKRASGSRGRRPRPPLPPPARARPLPPPARARPMP 562 >At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-associated herpes-like virus ORF73gene, Kaposi's sarcoma-associated herpesvirus, U52064 Length = 532 Score = 31.1 bits (67), Expect = 0.38 Identities = 25/103 (24%), Positives = 45/103 (43%) Frame = -3 Query: 423 KSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPKLRR 244 + T +E KEK+ S++++ + + K S+Q KEE ++K+ E + + Sbjct: 291 QQTKNEEDEKEKVQSSEEESKVKESGKNEKDASSSQDESKEEKPERKKKEESSSQGEGKE 350 Query: 243 CTRVPEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPT 115 PE+ + +S+ E E E EA + IK T Sbjct: 351 --EEPEKREKEDSSSQEESKEEEPENKEKEASSSQEENEIKET 391 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 31.1 bits (67), Expect = 0.38 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -3 Query: 201 SRAEHPEPEVPPPGLEALAPPSRRSIK-PTFHTTLKPTCNNHL 76 S A HP P PPP P + S+ PT + KP N H+ Sbjct: 108 STASHPPPAPPPPASLPTFPANISSLLFPTHNKQSKPPSNGHI 150 >At1g79350.1 68414.m09247 DNA-binding protein, putative contains Pfam PF00628: PHD-finger domain; contains TIGRFAMS TIGR01053: zinc finger domain, LSD1 subclass; contains Pfam PF00271: Helicase conserved C-terminal domain; similar to WSSV086 (GI:19481678)[shrimp white spot syndrome virus]; similar to nuclear protein Np95 (GI:17939938) [Mus musculus] Length = 1299 Score = 31.1 bits (67), Expect = 0.38 Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -3 Query: 219 PEVCRASRAEHPE-PEVPPPGLEALAPPSRRSIKP 118 PE+ +R + P+ P+ PP ++ L PP ++ +KP Sbjct: 61 PELLSRARPQFPQSPQQPPQPIQTLPPPIQQQLKP 95 >At1g11660.1 68414.m01339 heat shock protein, putative strong similarity to gb|Z70314 heat-shock protein from Arabidopsis thaliana and is a member of the PF|00012 Hsp70 protein family Length = 773 Score = 30.3 bits (65), Expect = 0.66 Identities = 16/68 (23%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = -3 Query: 456 KNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWL-DSNQLADKEEYEHKQK 280 KNALES+ + M+ M + + ++S+++ I +T +WL + + Y K Sbjct: 592 KNALESFVYEMRDKMLN-TYRNTATESERECIARNLQETEEWLYEDGDDESENAYIEKLN 650 Query: 279 ELEGIYNP 256 +++ + +P Sbjct: 651 DVKKLIDP 658 >At5g01570.1 68418.m00072 hypothetical protein hypothetical protein T16O11.19 - Arabidopsis thaliana, EMBL:AC010871 Length = 157 Score = 29.9 bits (64), Expect = 0.88 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = -3 Query: 408 DEKLKEKISDS--DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 271 DE KE I +S D Q LD C + +S ++AD+EE E QKEL+ Sbjct: 46 DEDFKE-IHESLQDLQKKLDVCKEKTDEANS-EIADEEEIERLQKELD 91 >At5g52530.2 68418.m06518 dentin sialophosphoprotein-related contains weak similarity to dentin sialophosphoprotein precursor (Dentin matrix protein-3) (DMP- 3) (Swiss-Prot:P97399) [Mus musculus] Length = 828 Score = 29.5 bits (63), Expect = 1.2 Identities = 21/62 (33%), Positives = 28/62 (45%) Frame = -3 Query: 321 NQLADKEEYEHKQKELEGIYNPKLRRCTRVPEESPEVCRASRAEHPEPEVPPPGLEALAP 142 N+LAD++ EH + GI PK + C + E S E P+ V E LAP Sbjct: 230 NELADEQSVEHSRVTSGGIIAPK-KTCIALSNE-------SSTERPKDNVEASESEPLAP 281 Query: 141 PS 136 S Sbjct: 282 DS 283 >At5g52530.1 68418.m06517 dentin sialophosphoprotein-related contains weak similarity to dentin sialophosphoprotein precursor (Dentin matrix protein-3) (DMP- 3) (Swiss-Prot:P97399) [Mus musculus] Length = 828 Score = 29.5 bits (63), Expect = 1.2 Identities = 21/62 (33%), Positives = 28/62 (45%) Frame = -3 Query: 321 NQLADKEEYEHKQKELEGIYNPKLRRCTRVPEESPEVCRASRAEHPEPEVPPPGLEALAP 142 N+LAD++ EH + GI PK + C + E S E P+ V E LAP Sbjct: 230 NELADEQSVEHSRVTSGGIIAPK-KTCIALSNE-------SSTERPKDNVEASESEPLAP 281 Query: 141 PS 136 S Sbjct: 282 DS 283 >At5g24880.1 68418.m02946 expressed protein ; expression supported by MPSS Length = 443 Score = 29.5 bits (63), Expect = 1.2 Identities = 26/98 (26%), Positives = 36/98 (36%) Frame = -3 Query: 456 KNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 277 K+ L S S KS E + SDK+ LD + + D + K E +H Q Sbjct: 157 KSGLNSSSTSSKSKKEGSENVRIKKASDKEIALDSASMSSAQEDHQEEILKVESDHLQVS 216 Query: 276 LEGIYNPKLRRCTRVPEESPEVCRASRAEHPEPEVPPP 163 I PK + + +E S E E P P Sbjct: 217 DHDIEEPKYEKEEKEVQEKVVQANESVEEKAESSGPTP 254 Score = 26.6 bits (56), Expect = 8.2 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = -3 Query: 411 EDEKLKEKISDSD-KQTILDKCNDTIKW-LDSNQLADKEEYEHKQKEL 274 E+EK KEK+ + D K+ + ++ + +K + ++ ++E E K+KE+ Sbjct: 349 EEEKEKEKVKEDDQKEKVEEEEKEKVKGDEEKEKVKEEESAEGKKKEV 396 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 29.5 bits (63), Expect = 1.2 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -3 Query: 414 MEDEKLKEKISDS--DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 277 M LKEK+ S D T+L++C + ++W + +E + K+KE Sbjct: 238 MPPRDLKEKLRKSVADLTTVLERCLNRLEWDRFQEEEKNKEEDEKEKE 285 >At5g16730.1 68418.m01959 expressed protein weak similarity to microtubule binding protein D-CLIP-190 [Drosophila melanogaster] GI:2773363, SMC2-like condensin [Arabidopsis thaliana] GI:14279543 Length = 853 Score = 28.7 bits (61), Expect = 2.0 Identities = 20/61 (32%), Positives = 28/61 (45%) Frame = -3 Query: 453 NALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKEL 274 N +E + K +E EK KEK +S D K +S Q+ KE + K+ EL Sbjct: 730 NGMEEKEVNGKPEVETEK-KEKKDESQDDDKDDSVEVIFKMWESCQIEKKEAFPDKKSEL 788 Query: 273 E 271 E Sbjct: 789 E 789 >At4g09950.1 68417.m01628 avirulence-responsive family protein / avirulence induced gene (AIG1) family protein similar to AIG1 protein SP:P54120 [Arabidopsis thaliana]; contains Pfam PF04548: AIG1 family; Length = 336 Score = 28.7 bits (61), Expect = 2.0 Identities = 17/54 (31%), Positives = 32/54 (59%) Frame = -3 Query: 405 EKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPKLRR 244 E +KEKIS+ K+++ D +K + A++EE E K E++ + + ++RR Sbjct: 262 EGIKEKISNQLKESLED-----VKEQLAKAQAEREETEKKMNEIQKLSSDEIRR 310 >At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family protein Common family member: At2g32840 [Arabidopsis thaliana] Length = 332 Score = 28.7 bits (61), Expect = 2.0 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 Query: 186 PEPEVPPPGLEALAPPSRRSIKPTFH 109 P P PPP L PP+ R I P H Sbjct: 34 PPPSQPPPAPPPLPPPTYRPIAPLRH 59 >At5g17890.1 68418.m02098 LIM domain-containing protein / disease resistance protein-related low similarity to disease resistance protein RPP4 [Arabidopsis thaliana] GI:20270890; contains Pfam profiles PF00412: LIM domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1613 Score = 28.3 bits (60), Expect = 2.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 336 KWLDSNQLADKEEYEHKQKELEGIYNPKLRRC 241 K LD ++ +KE+ +H + +E NP L +C Sbjct: 1209 KQLDDDKADEKEQIKHSKDHVEEEVNPPLSKC 1240 >At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family protein sequencing discrepancy between cDNA and genomic sequence prevents representation of entire coding sequence Length = 578 Score = 28.3 bits (60), Expect = 2.7 Identities = 13/53 (24%), Positives = 22/53 (41%) Frame = -3 Query: 222 SPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPTCNNHLVTSP 64 +P R P +PPP + +APP +++ P ++ P SP Sbjct: 463 TPSANRVRSPPSPRSVMPPPPPKTIAPPPSKTMSPPSSKSMLPPPPRSKTMSP 515 >At1g53250.1 68414.m06034 expressed protein Length = 363 Score = 28.3 bits (60), Expect = 2.7 Identities = 14/61 (22%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = -3 Query: 423 KSTMEDEKLKEKISDSDKQTILDKCND-TIKWLDSNQLADKEEYEHKQKELEGIYNPKLR 247 K T D KI + +++ + N + W + ++ KQ+ +E + NPK+R Sbjct: 80 KDTEADSDSDRKIKEEERRRKIGLANKGKVPWNKGRKHSEDTRRRIKQRTIEALTNPKVR 139 Query: 246 R 244 + Sbjct: 140 K 140 >At5g27230.1 68418.m03248 expressed protein ; expression supported by MPSS Length = 948 Score = 27.9 bits (59), Expect = 3.5 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Frame = -3 Query: 447 LESYCFSMKSTMEDE-KLKEKISDSDKQTILD--KCNDTIKWLDSNQLADKEEYEHKQKE 277 +ESY S +S +E+ K E + +S K L+ K + +D + A + E+E K+K+ Sbjct: 42 IESYFDSTRSVLEERAKELEALEESIKVKALELEKKEKELCLIDESMKAKQSEFEKKEKD 101 Query: 276 LE 271 + Sbjct: 102 FD 103 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 27.9 bits (59), Expect = 3.5 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = -3 Query: 210 CRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPT 91 C S P P P PP ++KP HT PT Sbjct: 26 CDCSDPPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPT 65 >At3g48580.1 68416.m05304 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative similar to endoxyloglucan transferase EXGT-A4 GI:5139002 from [Arabidopsis thaliana] Length = 277 Score = 27.9 bits (59), Expect = 3.5 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -3 Query: 360 LDKCNDTIKWLDSNQLADKEE--YEHKQKE-LEGIYNPKLRRCTRVPEE 223 +DKC D W + QL+ KE+ Y + +K L+ Y +R +VP+E Sbjct: 224 IDKCTDPKFWWNRKQLSSKEKTLYLNARKTYLDYDYCSDRQRYPKVPQE 272 >At3g29410.1 68416.m03695 terpene synthase/cyclase family protein similar to terpene synthase GB:CAA72074 from [Arabidopsis thaliana], contains Pfam profile: PF01397 terpene synthase family Length = 603 Score = 27.9 bits (59), Expect = 3.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 309 DKEEYEHKQKELEGIYNPKLRRCTRVPEES 220 D E+E +KE+E ++ PK+R P S Sbjct: 84 DDSEFEALEKEIETVFKPKVRDMLMSPHSS 113 >At1g44910.1 68414.m05146 FF domain-containing protein / WW domain-containing protein contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 946 Score = 27.9 bits (59), Expect = 3.5 Identities = 15/57 (26%), Positives = 32/57 (56%) Frame = -3 Query: 435 CFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGI 265 C +K+ + K+++++ D D+ + L+K + I + + +KEE E K+ E E + Sbjct: 550 CDYIKAGTQWRKIQDRLEDDDRCSCLEKIDRLIGFEEYILDLEKEEEELKRVEKEHV 606 >At5g60030.1 68418.m07527 expressed protein Length = 292 Score = 27.5 bits (58), Expect = 4.7 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -3 Query: 408 DEKLKEKISDSDKQTILD--KCNDTIKWLDSNQLADKEEYEHKQKELE 271 DEK+KEK+ D K K + K D + + +KE+ E +QK E Sbjct: 166 DEKVKEKLEDEQKSADRKERKKKKSKKNNDEDVVDEKEKLEDEQKSAE 213 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 27.5 bits (58), Expect = 4.7 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = -3 Query: 222 SPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPTCNNHLVTSP 64 SP+ +A P+ E+ PP LE + P + KP +H ++P Sbjct: 408 SPKPTPTPKAPEPKKEINPPNLEEPSKPKPEESPKPQQPSPKPETPSHEPSNP 460 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 27.5 bits (58), Expect = 4.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 333 WLDSNQLADKEEYEHKQKELEGIYNPKL 250 +L SNQ + + ++EH K L+ Y PKL Sbjct: 402 YLSSNQKSIEWDHEHVYKFLKNYYGPKL 429 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 27.5 bits (58), Expect = 4.7 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 210 CRASRAEHPEPEV-PPPGLEALAPPSRRSIKP 118 C S A P P++ PPP + L PP S P Sbjct: 95 CSGSGAPPPPPDLFPPPSAQMLPPPPASSPAP 126 >At1g63770.2 68414.m07216 peptidase M1 family protein similar to SP|P04825 Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoacylpeptide hydrolase) {Escherichia coli}; contains Pfam profile PF01433: Peptidase family M1 Length = 945 Score = 27.5 bits (58), Expect = 4.7 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 309 DKEEYEHKQKELEGIYNPKLRRCTRVPEE 223 D E Y HK LEG+Y CT+ E Sbjct: 191 DTEIYPHKNTSLEGLYKSSGNFCTQCEAE 219 >At1g63770.1 68414.m07217 peptidase M1 family protein similar to SP|P04825 Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoacylpeptide hydrolase) {Escherichia coli}; contains Pfam profile PF01433: Peptidase family M1 Length = 918 Score = 27.5 bits (58), Expect = 4.7 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 309 DKEEYEHKQKELEGIYNPKLRRCTRVPEE 223 D E Y HK LEG+Y CT+ E Sbjct: 191 DTEIYPHKNTSLEGLYKSSGNFCTQCEAE 219 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 27.5 bits (58), Expect = 4.7 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -3 Query: 258 PKLRRCTRVPEESPEVCRASRAEHPEPEVPPPGLEALAPP 139 P L P P RA+ A P P PPPG A PP Sbjct: 514 PPLPTTIAAPPPPPPPPRAAVAPPPPP--PPPGTAAAPPP 551 >At1g34350.1 68414.m04264 expressed protein Length = 163 Score = 27.5 bits (58), Expect = 4.7 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 284 RKNWKAFTIRNYEDVPG 234 RKNWK+F+ +NY D G Sbjct: 97 RKNWKSFSTQNYFDSNG 113 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 27.5 bits (58), Expect = 4.7 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 189 HPEPEVPPPGLEALAPPSRRSIKPTFHTTLKP 94 HP P PP + PP + + P +KP Sbjct: 59 HPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKP 90 >At5g55070.1 68418.m06864 2-oxoacid dehydrogenase family protein similar to SP|Q01205 Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor (EC 2.3.1.61) {Rattus norvegicus}; contains Pfam profiles PF00198: 2-oxo acid dehydrogenases acyltransferase (catalytic domain), PF00364: Biotin-requiring enzyme Length = 464 Score = 27.1 bits (57), Expect = 6.2 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -3 Query: 231 PEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIK 121 P E P+V AE P+ PPP PPS++S K Sbjct: 194 PAEKPKVESTKVAEKPKAPSPPP-----PPPSKQSAK 225 >At5g08480.2 68418.m01002 VQ motif-containing protein contains PF05678: VQ motif Length = 173 Score = 27.1 bits (57), Expect = 6.2 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -3 Query: 189 HPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPTCNNHLVTSP 64 H + P LE + PP S KPT T + N +L+TSP Sbjct: 65 HERRQCMRPKLEIVKPPL--SFKPTGTTPSSKSGNTNLLTSP 104 >At4g09160.1 68417.m01517 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to polyphosphoinositide binding protein Ssh1p (GI:2739044) {Glycine max}; similar to polyphosphoinositide binding protein Ssh2, Glycine max, gb:T05953; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 668 Score = 27.1 bits (57), Expect = 6.2 Identities = 31/118 (26%), Positives = 45/118 (38%), Gaps = 1/118 (0%) Frame = -3 Query: 417 TMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHK-QKELEGIYNPKLRRC 241 T+E E L DS++ + +T K N A+ E H+ E E + + L Sbjct: 73 TLESEGLNHAAEDSEQTHEVTPETETAKLEVLNHTAEDSEQTHEVTPEKETVKSEFLNHV 132 Query: 240 TRVPEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPTCNNHLVTS 67 E++ EV E + EV E P R + PT T + LVTS Sbjct: 133 AEDSEQTHEV--TPETETVKSEVLNHAAEDSEQP--RGVTPTPETETSEADTSLLVTS 186 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 27.1 bits (57), Expect = 6.2 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -3 Query: 378 SDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGI 265 +D++T + + ++ I L+ + A EY HK KELE + Sbjct: 2336 ADQKTEITQLSEHISELNLHAEAQASEYMHKFKELEAM 2373 >At2g16880.1 68415.m01942 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 743 Score = 27.1 bits (57), Expect = 6.2 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = -3 Query: 453 NALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKEL 274 N L CF + ++E KL E++ + + N ++KWL + +E K KEL Sbjct: 349 NTLIDGCFELGLSLEARKLMEQMENDGVKANQVTHNISLKWLCKEE--KREAVTRKVKEL 406 >At4g14340.1 68417.m02208 casein kinase I (CKI1) identical to casein kinase I [Arabidopsis thaliana] gi|1103318|emb|CAA55395 Length = 457 Score = 26.6 bits (56), Expect = 8.2 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -3 Query: 219 PEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLK 97 P++ +SR P P P P L+ PP+ R+ KPT L+ Sbjct: 302 PQIGSSSR---PRP-TPRPALDPPGPPAERAEKPTVGQDLR 338 >At4g10740.1 68417.m01754 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640: F-box protein interaction domain Length = 427 Score = 26.6 bits (56), Expect = 8.2 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -3 Query: 291 HKQKELEG--IYNPKLRRCTRVPEESPEVCRASRAEHPEPEVP 169 H+ E EG +YN LR T SP++ R H PE P Sbjct: 142 HRTSEWEGRDVYNYALRYETNSGNRSPKILRFIDDFHHHPENP 184 >At3g51350.1 68416.m05622 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 26.6 bits (56), Expect = 8.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 186 PEPEVPPPGLEALAPPSRRSIKPTFHTTLKP 94 P PEV P APP RS+ PT T P Sbjct: 464 PPPEVEAPAPSVSAPPP-RSLPPTVSATPPP 493 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 26.6 bits (56), Expect = 8.2 Identities = 17/57 (29%), Positives = 22/57 (38%) Frame = -3 Query: 234 VPEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPTCNNHLVTSP 64 VP +P V P P PPP + PS + PT T P+ + T P Sbjct: 162 VPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPP 218 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 26.6 bits (56), Expect = 8.2 Identities = 17/51 (33%), Positives = 21/51 (41%) Frame = -3 Query: 267 IYNPKLRRCTRVPEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPT 115 +YNP + C P P R HP+P PPP P +S PT Sbjct: 117 LYNPTI--CPPPPPPYP------RQVHPQPPAPPPYKFHQKEPVAKSFPPT 159 >At2g41960.1 68415.m05191 expressed protein Length = 1215 Score = 26.6 bits (56), Expect = 8.2 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = -3 Query: 414 MEDEKLKEKISDSDKQTI-LDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPKLRRCT 238 + E L++++ + K+ + L+K N K L+ + +EE E K+++ KLRR Sbjct: 475 LSSELLEQRVHIACKEIVTLEKQN---KLLEEEEKEKREEEERKERKRIKEREKKLRRKE 531 Query: 237 RVPEESPE 214 R+ E+ E Sbjct: 532 RLKEKERE 539 >At2g29090.1 68415.m03536 cytochrome P450 family protein similar to Cytochrome P450 88A3 (SP:O23051) [Arabidopsis thaliana]; similar to taxane 13-alpha-hydroxylase (GI:17148242) [Taxus cuspidata]. Length = 482 Score = 26.6 bits (56), Expect = 8.2 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = -3 Query: 288 KQKELEGIYNPKLRRCTRVPEESPEVCR---ASRAEHPEPEVPPPGLEALAPPSRRSIKP 118 +Q + I+ + C V SPE R S+A +P PP + P + + Sbjct: 77 RQNKYGDIFKTHILGCPCVMISSPEAARMVLVSKAHLFKPTYPPSKERMIGPEALFFHQG 136 Query: 117 TFHTTLK 97 +H+TLK Sbjct: 137 PYHSTLK 143 >At2g02870.1 68415.m00237 kelch repeat-containing F-box family protein weak similarity to Kelch-like protein 5 (Swiss-Prot:Q96PQ7) [Homo sapiens]; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 467 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 264 YNPKLRRCTRVPEESPEVCRASRAE-HPEPEVPP 166 Y+ + ++ T++P+ SP RA +A+ P E PP Sbjct: 329 YDLETKKWTQIPDLSPPRSRADQADMSPAAEAPP 362 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 26.6 bits (56), Expect = 8.2 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -3 Query: 195 AEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPTCNNHLVTSP 64 AE PE PP +PPS S TT P +N TSP Sbjct: 2 AEGQSPENSPPAPPPPSPPSPPSSNDQ-QTTSPPPSDNQETTSP 44 >At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase PG1 GI:5669846, PG2 GI:5669848 from [Glycine max]; contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 475 Score = 26.6 bits (56), Expect = 8.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 Query: 189 HPEPEVPPPGLEALAPPSR 133 HP P PPP LE PP + Sbjct: 40 HPLPPPPPPPLETANPPDQ 58 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 26.6 bits (56), Expect = 8.2 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 219 PEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKP 118 P + S+ P PE+ PP +AL PP S P Sbjct: 861 PPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPP 894 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,707,158 Number of Sequences: 28952 Number of extensions: 180593 Number of successful extensions: 1075 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1043 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 772134480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -