BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0330 (742 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.0 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 4.0 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 3.0 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -3 Query: 158 FVL-SLAV-LRAVQAGLHQCHHRRDL 87 FVL SLAV L AGL C H RDL Sbjct: 1079 FVLHSLAVELEHGAAGLRLCLHHRDL 1104 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 428 VVENDINAGSSHYIIGPFQNKSYETVVVRVEI 523 + N + S+ I PF+N+S V+V + Sbjct: 256 ISRNGVRLSSARAFITPFENRSNLHVIVNATV 287 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,878 Number of Sequences: 438 Number of extensions: 4154 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -