BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0327 (638 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 2.5 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 3.3 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 4.4 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 7.6 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 23.0 bits (47), Expect = 2.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 481 PEGI*QAGLRVT*SGRRVRPTHYSELERSTR 573 P+G+ G + +GR V P +Y L+ + R Sbjct: 372 PQGMNILGDLIEGTGRSVNPRYYGSLQAAAR 402 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 495 TSWTARHMKWTAGSADTLFGVG 560 T W HM + + D+ FG+G Sbjct: 206 TEWEIVHMSHSESTIDSKFGLG 227 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/21 (38%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 471 VQSTRRYLTS-WTARHMKWTA 530 + +T ++T WT H+KW A Sbjct: 51 ILTTNCWVTQIWTDHHLKWNA 71 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 7.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 354 TPASQPW*FSTAATSTT 304 +PAS P S AATS+T Sbjct: 822 SPASSPRYLSAAATSST 838 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,329 Number of Sequences: 438 Number of extensions: 3792 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -