BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0325 (687 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 87 2e-19 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 87 2e-19 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 80 1e-17 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 3.1 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 23 3.1 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 9.5 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 86.6 bits (205), Expect = 2e-19 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = +1 Query: 511 LGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVXEFKRE 657 LGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNR+V + +FK++ Sbjct: 28 LGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEYCTQDFKKK 76 Score = 48.8 bits (111), Expect = 4e-08 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = +2 Query: 431 INEPTAAAIAYGLDKKGTGERNVLIF 508 INEPTAAAIAYGLDKK ERNVLIF Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIF 26 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 86.6 bits (205), Expect = 2e-19 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = +1 Query: 511 LGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVXEFKRE 657 LGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNR+V + +FK++ Sbjct: 28 LGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEYCTQDFKKK 76 Score = 48.8 bits (111), Expect = 4e-08 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = +2 Query: 431 INEPTAAAIAYGLDKKGTGERNVLIF 508 INEPTAAAIAYGLDKK ERNVLIF Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIF 26 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 80.2 bits (189), Expect = 1e-17 Identities = 35/56 (62%), Positives = 49/56 (87%) Frame = +1 Query: 511 LGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVXEFKREITKKDLR 678 LGGGTFDVSILTI++G+FEV +T+GDTHLGGEDFD +++++F+ K++ KKD+R Sbjct: 27 LGGGTFDVSILTIDNGVFEVVATSGDTHLGGEDFDQKVMDYFIKMVKQK-HKKDIR 81 Score = 44.4 bits (100), Expect = 9e-07 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = +2 Query: 431 INEPTAAAIAYGLDKKGTGERNVLIF 508 INEPTAAAIAYGLDKKG E+N+L++ Sbjct: 1 INEPTAAAIAYGLDKKG-AEQNILVY 25 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 386 TKDAGTISGLNVLRIINEPTAA 451 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 22.6 bits (46), Expect = 3.1 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = +1 Query: 274 FH-GAYENEGNCRSL---SWQNCA---ECSYHGSRVLQ*LSKTSHKRCR 399 FH GA+ EG C+S ++ N + EC +G V+ ++T+ K CR Sbjct: 15 FHFGAFTCEG-CKSFFGRTYNNISSISECKNNGECVINKKNRTACKACR 62 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 575 PPPATPTWEVRTL 613 PP PTW VR L Sbjct: 13 PPQEMPTWFVRWL 25 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,628 Number of Sequences: 336 Number of extensions: 3645 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -