BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0325 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 105 2e-24 AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 25 1.7 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 25 1.7 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 9.0 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 9.0 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 9.0 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 9.0 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 105 bits (251), Expect = 2e-24 Identities = 50/58 (86%), Positives = 54/58 (93%) Frame = +2 Query: 335 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIF 508 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIF Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIF 58 Score = 33.9 bits (74), Expect = 0.005 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 511 LGGGTFDVSILTIEDG 558 LGGGTFDVSILTI++G Sbjct: 60 LGGGTFDVSILTIDEG 75 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -1 Query: 603 TSQVGVAGGGFHLEDTILDGKDGHVEGTAAEVKISTFRSPVP 478 T ++G G + D I D H A + FRSP+P Sbjct: 364 TCRLGECSLGCLVADAIADYYTNHTFHPVAIINAGNFRSPIP 405 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -1 Query: 603 TSQVGVAGGGFHLEDTILDGKDGHVEGTAAEVKISTFRSPVP 478 T ++G G + D I D H A + FRSP+P Sbjct: 364 TCRLGECSLGCLVADAIADYYTNHTFHPVAIINAGNFRSPIP 405 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 325 NCAECSYHGSRVLQ*LSKTSHKR-CRY 402 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 325 NCAECSYHGSRVLQ*LSKTSHKR-CRY 402 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 325 NCAECSYHGSRVLQ*LSKTSHKR-CRY 402 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 325 NCAECSYHGSRVLQ*LSKTSHKR-CRY 402 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 750,112 Number of Sequences: 2352 Number of extensions: 15653 Number of successful extensions: 37 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -