BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0324 (708 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC211.04c |mcm6|mis5|MCM complex subunit Mcm6 |Schizosaccharom... 28 1.1 SPAC20H4.09 |||ATP-dependent RNA helicase, spliceosomal |Schizos... 27 2.6 >SPBC211.04c |mcm6|mis5|MCM complex subunit Mcm6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 892 Score = 28.3 bits (60), Expect = 1.1 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 6/66 (9%) Frame = -3 Query: 523 RSCQ*HAAVHAGDLTAAHVR------HLEVSVEQQLTAKRQLLARVVHADVEVELLLTQD 362 RS + V AGDL +++ H E + ++ R++L R+VH + +E+ D Sbjct: 802 RSTEGVDGVPAGDLVQSYLELREDQFHTEEDIIYEVGLVRKVLTRLVHESIIMEIQNLTD 861 Query: 361 QPVRQP 344 VR P Sbjct: 862 SAVRLP 867 >SPAC20H4.09 |||ATP-dependent RNA helicase, spliceosomal |Schizosaccharomyces pombe|chr 1|||Manual Length = 647 Score = 27.1 bits (57), Expect = 2.6 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 260 ERLPSGDVEAVFSLMDDEFTRSMWHFQFRLTYRLI 364 +RLPS D + + D F R++ H Q +Y+ I Sbjct: 559 QRLPSSDCSKILKCLLDGFVRNVAHLQNDGSYKTI 593 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,849,628 Number of Sequences: 5004 Number of extensions: 56072 Number of successful extensions: 154 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -