BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0318 (629 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 24 0.91 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 24 1.2 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 24 1.2 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 6.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.4 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 6.4 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 24.2 bits (50), Expect = 0.91 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +3 Query: 303 QEFKINSTHSHEVHHNEKEE 362 Q + N TH++E++H+ KEE Sbjct: 33 QNTEHNYTHNNEMYHSVKEE 52 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 303 QEFKINSTHSHEVHHNEKEE 362 Q + N TH++E++H KEE Sbjct: 33 QNTEQNYTHNNEMYHRVKEE 52 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 303 QEFKINSTHSHEVHHNEKEE 362 Q + N TH++E++H KEE Sbjct: 33 QNTEQNYTHNNEMYHRVKEE 52 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 6.4 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +3 Query: 276 KQWVITNIAQEFKINSTHSHEVHHNEKEEVTGVGYSNEQFAITVGSFGTV 425 ++W+ + +A + + H V NE + +GY TV GT+ Sbjct: 618 RRWMPSTMANILDLLMDYEHTVKINENISMPYIGYQIILMIGTVIGPGTI 667 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.4 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +3 Query: 276 KQWVITNIAQEFKINSTHSHEVHHNEKEEVTGVGYSNEQFAITVGSFGTV 425 ++W+ + +A + + H V NE + +GY TV GT+ Sbjct: 851 RRWMPSTMANILDLLMDYEHTVKINENISMLYIGYQIILMIGTVIGPGTI 900 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.4 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +3 Query: 276 KQWVITNIAQEFKINSTHSHEVHHNEKEEVTGVGYSNEQFAITVGSFGTV 425 ++W+ + +A + + H V NE + +GY TV GT+ Sbjct: 851 RRWMPSTMANILDLLMDYEHTVKINENISMLYIGYQIILMIGTVIGPGTI 900 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.4 bits (43), Expect = 6.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 405 VGSFGTVVKWDLKSNVVKNYQHLL 476 VG+F +V DL VKN Q L+ Sbjct: 443 VGTFNSVFICDLIEQKVKNIQMLV 466 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,466 Number of Sequences: 336 Number of extensions: 3612 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -