BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0316 (751 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 4.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 9.3 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 22.6 bits (46), Expect = 4.0 Identities = 12/49 (24%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +2 Query: 365 SIHLLACHGSLVLYCRNKVCLSVELINWRIYVRKRRNQ--ASDIVMKAW 505 S+ +L C S++ C + + + IY R+RR++ A +++ W Sbjct: 116 SLDILLCTASILSLCAISIDRYLAVTQPLIYSRRRRSKRLAGLMIVAVW 164 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/18 (50%), Positives = 12/18 (66%), Gaps = 1/18 (5%) Frame = +2 Query: 317 PHAADFENGTGHSV-CES 367 P+ DF NGTG V C++ Sbjct: 10 PNRVDFSNGTGAVVECQA 27 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,427 Number of Sequences: 438 Number of extensions: 4391 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -