BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0310 (475 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 1.9 DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory pro... 21 4.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 4.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 4.4 AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical pro... 21 4.4 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 7.7 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 7.7 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 226 NWTEIXVLSKVEISHTKF 173 +WTEI + V S TKF Sbjct: 60 SWTEINAFANVSPSKTKF 77 >DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory protein 12 protein. Length = 127 Score = 21.4 bits (43), Expect = 4.4 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = -3 Query: 260 SELMSKAYLSSKLDRNSCSF*SGNFSYQVCQSIQXGTCPC 141 S+ + K Y++ LDR CS + ++Q C Sbjct: 37 SDRLLKNYVNCLLDRGKCSPDGQELKNNLADALQTSCSKC 76 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/35 (22%), Positives = 18/35 (51%) Frame = -3 Query: 317 ILMTGTLPXGADAYFSLVCSELMSKAYLSSKLDRN 213 +L + G + + + +++AY + K+DRN Sbjct: 72 VLGAAVVSKGTTLFMTSQIKKNVTRAYCNKKIDRN 106 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/35 (22%), Positives = 18/35 (51%) Frame = -3 Query: 317 ILMTGTLPXGADAYFSLVCSELMSKAYLSSKLDRN 213 +L + G + + + +++AY + K+DRN Sbjct: 72 VLGAAVVSKGTTLFMTSQIKKNVTRAYCNKKIDRN 106 >AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical protein protein. Length = 127 Score = 21.4 bits (43), Expect = 4.4 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = -3 Query: 260 SELMSKAYLSSKLDRNSCSF*SGNFSYQVCQSIQXGTCPC 141 S+ + K Y++ LDR CS + ++Q C Sbjct: 37 SDRLLKNYVNCLLDRGKCSPDGQELKNNLADALQTSCSKC 76 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 20.6 bits (41), Expect = 7.7 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 226 NWTEIXVLSKVEISHTKF 173 +WTEI + V TKF Sbjct: 60 SWTEINAFANVSPPKTKF 77 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 20.6 bits (41), Expect = 7.7 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -2 Query: 108 PRPPGCLRCFPIRP 67 P P G L +P RP Sbjct: 65 PSPRGALGAYPFRP 78 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,520 Number of Sequences: 336 Number of extensions: 1608 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11036865 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -