BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0310 (475 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 1.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.9 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 8.9 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.4 bits (48), Expect = 1.3 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = -3 Query: 272 SLVCSELMSKAYLSSKLDRNSCSF*SGNFSYQVCQSIQXGTCPC*FCD 129 S+V S+ +YL KL+RN + Q +C C CD Sbjct: 287 SVVVSDYSDYSYLDEKLERNDLDL--EKYEGISSTPSQASSCSCLDCD 332 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 20.6 bits (41), Expect = 8.9 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 287 ADAYFSLVCSELMSKAYLSSKLDRNS 210 +D+ +S CS S+ S + RNS Sbjct: 13 SDSGYSNTCSNSQSQRSSGSSISRNS 38 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 20.6 bits (41), Expect = 8.9 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 287 ADAYFSLVCSELMSKAYLSSKLDRNS 210 +D+ +S CS S+ S + RNS Sbjct: 13 SDSGYSNTCSNSQSQRSSGSSISRNS 38 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,490 Number of Sequences: 438 Number of extensions: 1936 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12805416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -