BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0309 (713 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 25 3.1 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 7.2 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 9.5 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 24.6 bits (51), Expect = 3.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -1 Query: 488 TLTLSRTNLLAQISFRIQAEFTCVALWDVQRYY 390 T+ L N+L + + + +C LW + YY Sbjct: 197 TVLLRHENILGYVGSDMTSRNSCTQLWLITHYY 229 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 677 KAXSITCRYTASPANKLYLMEQPLQL 600 +A S+ CR + +P +KL+ E + L Sbjct: 66 RATSVDCRTSLAPCSKLFAAEPRVAL 91 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +2 Query: 167 GKQASRCPSRRLKWTR--QKPVKCALRS 244 G+Q RC SRR K T+ ++ + ALR+ Sbjct: 297 GRQHDRCDSRRWKTTQFNRQSFRVALRA 324 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 776,604 Number of Sequences: 2352 Number of extensions: 16382 Number of successful extensions: 82 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -