BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0309 (713 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 6.6 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 8.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.8 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 6.6 Identities = 11/41 (26%), Positives = 16/41 (39%) Frame = -1 Query: 305 HSLRIFSGECIRVSMADPVAVILTRTSPAFGGSTSISSMDS 183 H R+ C + + DP + T S S S+DS Sbjct: 384 HGQRVMVRTCNGLELRDPSLFVETSASELVESSVLFPSLDS 424 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 560 FSQYTVVLEISLCKV 604 + QY VL +SLCK+ Sbjct: 102 WQQYPWVLGVSLCKI 116 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 242 ILTRTSPAFGGSTS 201 +L R SPAF G++S Sbjct: 920 LLERASPAFSGTSS 933 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,134 Number of Sequences: 438 Number of extensions: 4098 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -