BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0307 (695 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39807| Best HMM Match : Ribosomal_S8e (HMM E-Value=0) 173 9e-44 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 33 0.29 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_22712| Best HMM Match : Ribosomal_S8e (HMM E-Value=0.068) 32 0.39 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 31 0.67 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 31 0.89 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 31 0.89 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 31 1.2 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 31 1.2 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 31 1.2 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 31 1.2 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 31 1.2 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 30 1.6 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 30 2.1 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 30 2.1 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 30 2.1 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_37792| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 29 2.7 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 29 2.7 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 29 2.7 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 29 2.7 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 29 2.7 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 29 2.7 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 29 2.7 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 29 2.7 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 29 2.7 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 29 2.7 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 29 2.7 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 29 3.6 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 29 3.6 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 29 3.6 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 29 3.6 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 29 4.8 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 29 4.8 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 29 4.8 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 28 6.3 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 28 6.3 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 28 6.3 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 28 6.3 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 28 6.3 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 28 6.3 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 28 6.3 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 28 8.3 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 28 8.3 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 28 8.3 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 28 8.3 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 28 8.3 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 28 8.3 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 28 8.3 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_39807| Best HMM Match : Ribosomal_S8e (HMM E-Value=0) Length = 192 Score = 173 bits (422), Expect = 9e-44 Identities = 93/182 (51%), Positives = 109/182 (59%) Frame = +3 Query: 114 PIRKKRXYELGRPAAKHQARPSANPLRSFTWWXY*VPCXASGHR*LLWGSXXSTRKTRII 293 P+R KR +ELGRP A + WGS TRK RII Sbjct: 4 PLRHKRKFELGRPPANTKIGTKRIHEVRTRGGNRKFRAFRLDTENFSWGSESCTRKARII 63 Query: 294 DVVXNASNNXLVRTKTLVKNAIVVVDATPFRQWYESHYTLPLGRXKGAKLTEAEEAIINK 473 DVV NASNN LVRTKTLVKN IV VD+TPFRQWYE+HY +P+GR K + TE E+ I+NK Sbjct: 64 DVVYNASNNELVRTKTLVKNCIVQVDSTPFRQWYEAHYAIPIGRKKTKQPTEEEQEILNK 123 Query: 474 KRSQKTARKYLAGNVLLRLRVL*KSNSTQGVCWACVASRPGQCGRADGYILEGKELEFYL 653 KRS RK A ++ + G +ACV+SRPGQ GR DGYILEGKELEFY+ Sbjct: 124 KRSNHCTRKLEARKANAKVAPGMEEQFVTGRLYACVSSRPGQSGRCDGYILEGKELEFYI 183 Query: 654 KK 659 KK Sbjct: 184 KK 185 Score = 54.0 bits (124), Expect = 1e-07 Identities = 24/49 (48%), Positives = 32/49 (65%) Frame = +1 Query: 109 VRPYARRGSMS*GVPLPNTRLGPQRIHSVRSRGGXTKYRALRLDTGNFS 255 ++P + G P NT++G +RIH VR+RGG K+RA RLDT NFS Sbjct: 2 MKPLRHKRKFELGRPPANTKIGTKRIHEVRTRGGNRKFRAFRLDTENFS 50 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.3 bits (75), Expect = 0.096 Identities = 20/41 (48%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 149 TP*LILPLLAYGRTFPTGGPXXMPV-IPLVPNSCSPGDPLV 30 TP L L +T G P V I L+ NSCSPGDPLV Sbjct: 5 TPSWKLTLTKGNKTLVPGPPSRSTVSISLISNSCSPGDPLV 45 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.3 bits (75), Expect = 0.096 Identities = 20/41 (48%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 149 TP*LILPLLAYGRTFPTGGPXXMPV-IPLVPNSCSPGDPLV 30 TP L L +T G P V I L+ NSCSPGDPLV Sbjct: 5 TPSSKLTLTKGNKTLVPGPPSRSTVSISLISNSCSPGDPLV 45 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.3 bits (75), Expect = 0.096 Identities = 20/41 (48%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 149 TP*LILPLLAYGRTFPTGGPXXMPV-IPLVPNSCSPGDPLV 30 TP L L +T G P V I L+ NSCSPGDPLV Sbjct: 5 TPSSKLTLTKGNKTLVPGPPSRSTVSISLISNSCSPGDPLV 45 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -1 Query: 92 PXXMPVIPLVPNSCSPGDPLV 30 P IPL+ NSCSPGDPLV Sbjct: 46 PLLYTYIPLLSNSCSPGDPLV 66 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 +IP+V NSCSPGDPLV Sbjct: 8 LIPMVSNSCSPGDPLV 23 >SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = -1 Query: 140 LILPLLAYGRTFP--TGGPXXMPVIPLVP-NSCSPGDPLV 30 L+ A+ R+F TGG + +P NSCSPGDPLV Sbjct: 26 LLFTRFAFERSFSDDTGGGGRQSNVHFIPSNSCSPGDPLV 65 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.22 Identities = 20/41 (48%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 149 TP*LILPLLAYGRTFPTGGPXXMPV-IPLVPNSCSPGDPLV 30 TP L L R G P V I L+ NSCSPGDPLV Sbjct: 5 TPSSKLTLTKGNRKLVPGPPSRSTVSISLISNSCSPGDPLV 45 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.7 bits (71), Expect = 0.29 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 PLV NSCSPGDPLV Sbjct: 2 PLVSNSCSPGDPLV 15 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 32.7 bits (71), Expect = 0.29 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 80 PVIPLVPNSCSPGDPLV 30 P+ P++ NSCSPGDPLV Sbjct: 51 PLEPILSNSCSPGDPLV 67 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.29 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 149 TP*LILPLLAYGRTFPTGGPXXMPV-IPLVPNSCSPGDPLV 30 TP L L ++ G P V I L+ NSCSPGDPLV Sbjct: 5 TPSSKLTLTKGNKSLVPGPPSRSTVSISLISNSCSPGDPLV 45 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 PL+ NSCSPGDPLV Sbjct: 23 PLISNSCSPGDPLV 36 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 32.3 bits (70), Expect = 0.39 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 92 PXXMPVIPLVPNSCSPGDPLV 30 P + V+ +V NSCSPGDPLV Sbjct: 11 PYGLIVLTVVSNSCSPGDPLV 31 >SB_22712| Best HMM Match : Ribosomal_S8e (HMM E-Value=0.068) Length = 147 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 288 IIDVVXNASNNXLVRTKTLVKNAIVVVDATPFRQWYESH 404 I+ V+ + +N + +VK +IV VD PF W++ + Sbjct: 75 ILSVMHSFANKEHIERNVIVKGSIVQVDNKPFEDWFQEY 113 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/16 (87%), Positives = 15/16 (93%), Gaps = 1/16 (6%) Frame = -1 Query: 74 IPLVP-NSCSPGDPLV 30 +PLVP NSCSPGDPLV Sbjct: 25 LPLVPSNSCSPGDPLV 40 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.9 bits (69), Expect = 0.51 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = -1 Query: 134 LPLLAYGRTFPTGGPXXMPVIPLVPNSCSPGDPLV 30 L L RT+ G + V PL NSCSPGDPLV Sbjct: 42 LELYTTERTYVRGLETILEVQPL-SNSCSPGDPLV 75 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.51 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 149 TP*LILPLLAYGRTFPTGGPXXMPV-IPLVPNSCSPGDPLV 30 TP L L + G P V I L+ NSCSPGDPLV Sbjct: 5 TPSSKLTLTKGNKMLVPGPPSRSTVSISLISNSCSPGDPLV 45 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.9 bits (69), Expect = 0.51 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 149 TP*LILPLLAYGRTFPTGGPXXMPV-IPLVPNSCSPGDPLV 30 TP L L + G P V I L+ NSCSPGDPLV Sbjct: 3 TPSSKLTLTKGNKMLVPGPPSRSTVSISLISNSCSPGDPLV 43 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 31.5 bits (68), Expect = 0.67 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +2 Query: 29 ELVDPPGCRNSARAGXLA*XKGHRWETCAHTQEEXV*VRASRCQ 160 ELVDPPGCRNS ++ G + H + + +++S+ + Sbjct: 31 ELVDPPGCRNSIDGNGVSDGDGGSGDNDNHRKSDSSAIKSSQTE 74 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.5 bits (68), Expect = 0.67 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +2 Query: 29 ELVDPPGCRNSARAG 73 ELVDPPGCRNS + G Sbjct: 14 ELVDPPGCRNSIKYG 28 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 31.5 bits (68), Expect = 0.67 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 IP V NSCSPGDPLV Sbjct: 56 IPPVSNSCSPGDPLV 70 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 31.5 bits (68), Expect = 0.67 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 29 ELVDPPGCRNSARA 70 ELVDPPGCRNS R+ Sbjct: 14 ELVDPPGCRNSIRS 27 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.5 bits (68), Expect = 0.67 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 104 PTGGPXXMPVIPLVPNSCSPGDPLV 30 PT P LV NSCSPGDPLV Sbjct: 14 PTRYAILSPRARLVSNSCSPGDPLV 38 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 31.5 bits (68), Expect = 0.67 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 29 ELVDPPGCRNSARAGXLA 82 ELVDPPGCRNS G ++ Sbjct: 101 ELVDPPGCRNSITGGPVS 118 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 31.1 bits (67), Expect = 0.89 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 80 PVIPLVPNSCSPGDPLV 30 PV + NSCSPGDPLV Sbjct: 256 PVTEYISNSCSPGDPLV 272 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 31.1 bits (67), Expect = 0.89 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +2 Query: 29 ELVDPPGCRNSARAG 73 ELVDPPGCRNS G Sbjct: 14 ELVDPPGCRNSMHIG 28 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 31.1 bits (67), Expect = 0.89 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 29 ELVDPPGCRNSAR 67 ELVDPPGCRNS R Sbjct: 14 ELVDPPGCRNSIR 26 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 31.1 bits (67), Expect = 0.89 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 29 ELVDPPGCRNSARA 70 ELVDPPGCRNS +A Sbjct: 14 ELVDPPGCRNSIQA 27 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 31.1 bits (67), Expect = 0.89 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 PL NSCSPGDPLV Sbjct: 19 PLASNSCSPGDPLV 32 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 31.1 bits (67), Expect = 0.89 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 IP + NSCSPGDPLV Sbjct: 34 IPALSNSCSPGDPLV 48 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.1 bits (67), Expect = 0.89 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P++ NSCSPGDPLV Sbjct: 16 PVISNSCSPGDPLV 29 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.1 bits (67), Expect = 0.89 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 PL NSCSPGDPLV Sbjct: 6 PLASNSCSPGDPLV 19 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +2 Query: 29 ELVDPPGCRNSARAG 73 ELVDPPGCRNS G Sbjct: 14 ELVDPPGCRNSMSQG 28 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 95 GPXXMPVIPLVP-NSCSPGDPLV 30 GP PLV NSCSPGDPLV Sbjct: 881 GPSLSHPFPLVTSNSCSPGDPLV 903 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 Query: 107 FPTGGPXXMPVIPLVPNSCSPGDPLV 30 F +GGP + NSCSPGDPLV Sbjct: 862 FTSGGPPETSTVKR-SNSCSPGDPLV 886 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 I L+ NSCSPGDPLV Sbjct: 31 ISLISNSCSPGDPLV 45 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 92 PXXMPVIPLVPNSCSPGDPLV 30 P P + + NSCSPGDPLV Sbjct: 603 PPPPPPVHFLSNSCSPGDPLV 623 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +2 Query: 29 ELVDPPGCRNSARAGXL 79 ELVDPPGCRNS A L Sbjct: 14 ELVDPPGCRNSMVASEL 30 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 29 ELVDPPGCRNSARA 70 ELVDPPGCRNS A Sbjct: 14 ELVDPPGCRNSMNA 27 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 I L+ NSCSPGDPLV Sbjct: 32 ISLISNSCSPGDPLV 46 >SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 V+P NSCSPGDPLV Sbjct: 16 VLPAPSNSCSPGDPLV 31 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 VI + NSCSPGDPLV Sbjct: 48 VIAFISNSCSPGDPLV 63 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 +IP NSCSPGDPLV Sbjct: 10 IIPKPSNSCSPGDPLV 25 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 107 FPTGGPXXMPVIPLVPNSCSPGDPLV 30 + G ++P NSCSPGDPLV Sbjct: 12 YADNGTNGASLVPRPSNSCSPGDPLV 37 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P++ NSCSPGDPLV Sbjct: 14 PVLSNSCSPGDPLV 27 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 29 ELVDPPGCRNSARA 70 ELVDPPGCRNS A Sbjct: 14 ELVDPPGCRNSIAA 27 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -1 Query: 113 RTFPTGGPXXM-PVIPLVPNSCSPGDPLV 30 +T GP + P+ L NSCSPGDPLV Sbjct: 2 KTANIAGPTVLVPLTILGSNSCSPGDPLV 30 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 + L+ NSCSPGDPLV Sbjct: 31 VSLISNSCSPGDPLV 45 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -1 Query: 83 MPVIPLVPNSCSPGDPLV 30 + VI ++ NSCSPGDPLV Sbjct: 18 LEVIHVLSNSCSPGDPLV 35 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 PL NSCSPGDPLV Sbjct: 84 PLSSNSCSPGDPLV 97 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P+ NSCSPGDPLV Sbjct: 15 PITSNSCSPGDPLV 28 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 ++ L+ NSCSPGDPLV Sbjct: 13 IVFLISNSCSPGDPLV 28 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P + NSCSPGDPLV Sbjct: 43 PTISNSCSPGDPLV 56 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 V P + NSCSPGDPLV Sbjct: 6 VSPEISNSCSPGDPLV 21 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 LV NSCSPGDPLV Sbjct: 24 LVSNSCSPGDPLV 36 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 29 ELVDPPGCRNSAR 67 ELVDPPGCRNS + Sbjct: 14 ELVDPPGCRNSIK 26 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 29 ELVDPPGCRNSAR 67 ELVDPPGCRNS + Sbjct: 14 ELVDPPGCRNSMK 26 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 29 ELVDPPGCRNSARAGXLA 82 ELVDPPGCRNS LA Sbjct: 14 ELVDPPGCRNSILLTELA 31 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 + L+ NSCSPGDPLV Sbjct: 35 LDLISNSCSPGDPLV 49 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +2 Query: 29 ELVDPPGCRNSARAG 73 ELVDPPGCRNS G Sbjct: 14 ELVDPPGCRNSIVLG 28 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 LV NSCSPGDPLV Sbjct: 17 LVSNSCSPGDPLV 29 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 98 GGPXXMPVIPLVPNSCSPGDPLV 30 G P + + + NSCSPGDPLV Sbjct: 31 GDPVKVSISFFLSNSCSPGDPLV 53 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 29 ELVDPPGCRNSAR 67 ELVDPPGCRNS + Sbjct: 14 ELVDPPGCRNSIK 26 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 29 ELVDPPGCRNSAR 67 ELVDPPGCRNS + Sbjct: 14 ELVDPPGCRNSMK 26 >SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P+ NSCSPGDPLV Sbjct: 9 PVTSNSCSPGDPLV 22 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 I L+ NSCSPGDPLV Sbjct: 6 IYLISNSCSPGDPLV 20 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 LV NSCSPGDPLV Sbjct: 9 LVSNSCSPGDPLV 21 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 29 ELVDPPGCRNSAR 67 ELVDPPGCRNS + Sbjct: 69 ELVDPPGCRNSMK 81 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 +I +V NSCSPGDPLV Sbjct: 4 MIVVVSNSCSPGDPLV 19 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 29 ELVDPPGCRNSAR 67 ELVDPPGCRNS + Sbjct: 14 ELVDPPGCRNSIK 26 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 LV NSCSPGDPLV Sbjct: 5 LVSNSCSPGDPLV 17 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 LV NSCSPGDPLV Sbjct: 2 LVSNSCSPGDPLV 14 >SB_37792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +3 Query: 273 TRKTRIIDVVXNASNNXLVRTKTLVKNAIVVVDATPFR 386 T++ +I D++ N N VR +TL+ NA +++D F+ Sbjct: 18 TKRKKIADILSNEIRN--VRERTLILNAALIIDICVFK 53 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/20 (65%), Positives = 16/20 (80%), Gaps = 3/20 (15%) Frame = -1 Query: 80 PVIPLVP---NSCSPGDPLV 30 PV+ ++P NSCSPGDPLV Sbjct: 51 PVVGMLPRRSNSCSPGDPLV 70 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 LV NSCSPGDPLV Sbjct: 26 LVSNSCSPGDPLV 38 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 29 ELVDPPGCRNSAR 67 ELVDPPGCRNS + Sbjct: 14 ELVDPPGCRNSMK 26 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 VI + NSCSPGDPLV Sbjct: 6 VIRYISNSCSPGDPLV 21 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 V+ + NSCSPGDPLV Sbjct: 511 VVTFLSNSCSPGDPLV 526 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L+ NSCSPGDPLV Sbjct: 17 LISNSCSPGDPLV 29 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 34 ELVDPPGCRNS 44 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 92 PXXMPVIPLVPNSCSPGDPLV 30 P + V+ + NSCSPGDPLV Sbjct: 2 PYGLIVLTVGSNSCSPGDPLV 22 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 90 ELVDPPGCRNS 100 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 658 ELVDPPGCRNS 668 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 31 ELVDPPGCRNS 41 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 71 ELVDPPGCRNS 81 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -1 Query: 95 GPXXMPVIPLVPNSCSPGDPLV 30 G + V +V NSCSPGDPLV Sbjct: 3465 GKALIYVARVVSNSCSPGDPLV 3486 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P NSCSPGDPLV Sbjct: 1191 PFASNSCSPGDPLV 1204 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 I V NSCSPGDPLV Sbjct: 16 IAFVSNSCSPGDPLV 30 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 1/15 (6%) Frame = -1 Query: 71 PLVP-NSCSPGDPLV 30 P++P NSCSPGDPLV Sbjct: 63 PILPSNSCSPGDPLV 77 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P V NSCSPGDPLV Sbjct: 8 PGVSNSCSPGDPLV 21 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 I ++ NSCSPGDPLV Sbjct: 3 IVIISNSCSPGDPLV 17 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 51 ELVDPPGCRNS 61 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 80 PVIPLVPNSCSPGDPLV 30 P++ NSCSPGDPLV Sbjct: 19 PIVEKRSNSCSPGDPLV 35 >SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) Length = 415 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 319 ELVDPPGCRNS 329 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L+ NSCSPGDPLV Sbjct: 40 LISNSCSPGDPLV 52 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L+ NSCSPGDPLV Sbjct: 70 LISNSCSPGDPLV 82 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 14 ELVDPPGCRNS 24 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L+ NSCSPGDPLV Sbjct: 21 LISNSCSPGDPLV 33 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 90 ELVDPPGCRNS 100 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 101 ELVDPPGCRNS 111 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 29 ELVDPPGCRNS 61 ELVDPPGCRNS Sbjct: 77 ELVDPPGCRNS 87 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 +V NSCSPGDPLV Sbjct: 347 IVSNSCSPGDPLV 359 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 ++ + NSCSPGDPLV Sbjct: 12 IVQQISNSCSPGDPLV 27 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 V+ L NSCSPGDPLV Sbjct: 1017 VVGLGSNSCSPGDPLV 1032 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/56 (33%), Positives = 25/56 (44%) Frame = -1 Query: 197 RTEWIR*GPSLVFGSGTP*LILPLLAYGRTFPTGGPXXMPVIPLVPNSCSPGDPLV 30 + +W R G + G G PL GR+ ++ NSCSPGDPLV Sbjct: 78 KRDWRRRGVQGLSGKGWK--ARPLTEMGRSLCRQLVRAKNQKEIISNSCSPGDPLV 131 >SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) Length = 126 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 31 TSGSPGLQEFGTSG 72 TSGSPGLQEF T G Sbjct: 14 TSGSPGLQEFDTKG 27 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 +I + NSCSPGDPLV Sbjct: 15 LIKITSNSCSPGDPLV 30 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 +P NSCSPGDPLV Sbjct: 7 MPRASNSCSPGDPLV 21 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 +V NSCSPGDPLV Sbjct: 77 IVSNSCSPGDPLV 89 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 80 PVIPLVPNSCSPGDPLV 30 P+ NSCSPGDPLV Sbjct: 42 PIFKPTSNSCSPGDPLV 58 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 IP NSCSPGDPLV Sbjct: 13 IPKRSNSCSPGDPLV 27 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 +V NSCSPGDPLV Sbjct: 1 MVSNSCSPGDPLV 13 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 I V NSCSPGDPLV Sbjct: 7 ITAVSNSCSPGDPLV 21 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 +V NSCSPGDPLV Sbjct: 85 IVSNSCSPGDPLV 97 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 I L NSCSPGDPLV Sbjct: 9 IMLASNSCSPGDPLV 23 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 +V NSCSPGDPLV Sbjct: 13 IVSNSCSPGDPLV 25 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 83 MPVIPLVPNSCSPGDPLV 30 +P + NSCSPGDPLV Sbjct: 32 IPSTQMASNSCSPGDPLV 49 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 +V NSCSPGDPLV Sbjct: 6 IVSNSCSPGDPLV 18 >SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 92 PXXMPVIPLVPNSCSPGDPLV 30 P P NSCSPGDPLV Sbjct: 101 PIRFPFNGFTSNSCSPGDPLV 121 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 +V NSCSPGDPLV Sbjct: 1 MVSNSCSPGDPLV 13 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 104 PTGGPXXMPVIPLVPNSCSPGDPLV 30 P P P NSCSPGDPLV Sbjct: 6 PPSPPLKKPGYGPASNSCSPGDPLV 30 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -1 Query: 137 ILPLLAYGRTFPTGGPXXMPVIPLVPNSCSPGDPLV 30 IL L G + +P NSCSPGDPLV Sbjct: 491 ILKLWRLGESGSASARESVPSSSTPSNSCSPGDPLV 526 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 83 MPVIPLVPNSCSPGDPLV 30 +P V NSCSPGDPLV Sbjct: 21 VPFYCYVSNSCSPGDPLV 38 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 ++ NSCSPGDPLV Sbjct: 17 IISNSCSPGDPLV 29 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P + NSCSPGDPLV Sbjct: 160 PHLSNSCSPGDPLV 173 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L+ NSCSPGDPLV Sbjct: 62 LLSNSCSPGDPLV 74 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 +I + NSCSPGDPLV Sbjct: 31 IIASLSNSCSPGDPLV 46 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 92 PXXMPVIPLVPNSCSPGDPLV 30 P + V + NSCSPGDPLV Sbjct: 50 PLLIVVPSSISNSCSPGDPLV 70 >SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P NSCSPGDPLV Sbjct: 4 PFSSNSCSPGDPLV 17 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 I L NSCSPGDPLV Sbjct: 76 ILLTSNSCSPGDPLV 90 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 VI + NSCSPGDPLV Sbjct: 7 VISELSNSCSPGDPLV 22 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 83 MPVIPLVPNSCSPGDPLV 30 +P+ L NSCSPGDPLV Sbjct: 9 LPLPCLRSNSCSPGDPLV 26 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 80 PVIPLVPNSCSPGDPLV 30 PVI + NSCSPGDPLV Sbjct: 31 PVI-FLSNSCSPGDPLV 46 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 107 FPTGGPXXMPV-IPLVPNSCSPGDPLV 30 F P +P + V NSCSPGDPLV Sbjct: 49 FRASSPWRLPGNLRPVSNSCSPGDPLV 75 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 ++ NSCSPGDPLV Sbjct: 14 IISNSCSPGDPLV 26 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 ++ NSCSPGDPLV Sbjct: 13 IISNSCSPGDPLV 25 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L+ NSCSPGDPLV Sbjct: 2 LLSNSCSPGDPLV 14 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L+ NSCSPGDPLV Sbjct: 6 LLSNSCSPGDPLV 18 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 +P NSCSPGDPLV Sbjct: 11 LPQKSNSCSPGDPLV 25 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 92 PXXMPVIPLVPNSCSPGDPLV 30 P P P NSCSPGDPLV Sbjct: 8 PPRDPKRPHRSNSCSPGDPLV 28 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 92 PXXMPVIPLVPNSCSPGDPLV 30 P V P NSCSPGDPLV Sbjct: 36 PCSYLVDPARSNSCSPGDPLV 56 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 ++ NSCSPGDPLV Sbjct: 1 MISNSCSPGDPLV 13 >SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) Length = 134 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 VI NSCSPGDPLV Sbjct: 6 VISKTSNSCSPGDPLV 21 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L+ NSCSPGDPLV Sbjct: 1 LLSNSCSPGDPLV 13 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 ++ NSCSPGDPLV Sbjct: 4 IISNSCSPGDPLV 16 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L+ NSCSPGDPLV Sbjct: 7 LLSNSCSPGDPLV 19 >SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P NSCSPGDPLV Sbjct: 5 PQASNSCSPGDPLV 18 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 + L NSCSPGDPLV Sbjct: 659 LQLASNSCSPGDPLV 673 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 I + NSCSPGDPLV Sbjct: 18 IDIASNSCSPGDPLV 32 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 +V NSCSPGDPLV Sbjct: 27 VVSNSCSPGDPLV 39 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 ++ NSCSPGDPLV Sbjct: 13 IISNSCSPGDPLV 25 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 + V NSCSPGDPLV Sbjct: 13 IADFVSNSCSPGDPLV 28 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 ++ NSCSPGDPLV Sbjct: 26 IISNSCSPGDPLV 38 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 30 VSNSCSPGDPLV 41 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 80 PVIPLVPNSCSPGDPLV 30 P+ NSCSPGDPLV Sbjct: 76 PLSRFTSNSCSPGDPLV 92 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 7 VSNSCSPGDPLV 18 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 10 VSNSCSPGDPLV 21 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 15 VSNSCSPGDPLV 26 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 80 PVIPLVPNSCSPGDPLV 30 P + NSCSPGDPLV Sbjct: 57 PTAKKLSNSCSPGDPLV 73 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 2 VSNSCSPGDPLV 13 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L NSCSPGDPLV Sbjct: 15 LTSNSCSPGDPLV 27 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 40 VSNSCSPGDPLV 51 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 2/20 (10%) Frame = -1 Query: 83 MPVIPL--VPNSCSPGDPLV 30 +P+I + + NSCSPGDPLV Sbjct: 2 IPLIQIRGISNSCSPGDPLV 21 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 117 VSNSCSPGDPLV 128 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 184 VSNSCSPGDPLV 195 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 IPL NSCSPGDPLV Sbjct: 15 IPL-SNSCSPGDPLV 28 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 34 VSNSCSPGDPLV 45 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 1066 VSNSCSPGDPLV 1077 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 ++ NSCSPGDPLV Sbjct: 14 VISNSCSPGDPLV 26 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 3 VSNSCSPGDPLV 14 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 214 VSNSCSPGDPLV 225 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 110 TFPTGGPXXMPVIPLVPNSCSPGDPLV 30 TF T P + L NSCSPGDPLV Sbjct: 21 TFSTLKTKNAP-LKLSSNSCSPGDPLV 46 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 32 VSNSCSPGDPLV 43 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 I ++ NSCSPGDPLV Sbjct: 31 IGVLSNSCSPGDPLV 45 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L NSCSPGDPLV Sbjct: 5 LASNSCSPGDPLV 17 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 5 VSNSCSPGDPLV 16 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 3 VSNSCSPGDPLV 14 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 7 VSNSCSPGDPLV 18 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 4 VSNSCSPGDPLV 15 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 77 VIPLVPNSCSPGDPLV 30 ++ + NSCSPGDPLV Sbjct: 22 IMRITSNSCSPGDPLV 37 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L NSCSPGDPLV Sbjct: 6 LASNSCSPGDPLV 18 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 4 VSNSCSPGDPLV 15 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 104 PTGGPXXMPVIP--LVP-NSCSPGDPLV 30 P P P P L P NSCSPGDPLV Sbjct: 39 PCTPPLLSPCTPPHLSPSNSCSPGDPLV 66 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 11 VSNSCSPGDPLV 22 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 80 PVIPLVPNSCSPGDPLV 30 P I NSCSPGDPLV Sbjct: 9 PHIHRASNSCSPGDPLV 25 >SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P NSCSPGDPLV Sbjct: 23 PFGSNSCSPGDPLV 36 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 25 VSNSCSPGDPLV 36 >SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P NSCSPGDPLV Sbjct: 24 PNTSNSCSPGDPLV 37 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 15 VSNSCSPGDPLV 26 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L NSCSPGDPLV Sbjct: 17 LASNSCSPGDPLV 29 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 + + NSCSPGDPLV Sbjct: 2 VTIASNSCSPGDPLV 16 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 31 VSNSCSPGDPLV 42 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 4 VSNSCSPGDPLV 15 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 41 VSNSCSPGDPLV 52 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 15 VSNSCSPGDPLV 26 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 4 VSNSCSPGDPLV 15 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 14 VSNSCSPGDPLV 25 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 6 VSNSCSPGDPLV 17 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 ++ NSCSPGDPLV Sbjct: 5 VISNSCSPGDPLV 17 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 15 VSNSCSPGDPLV 26 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L NSCSPGDPLV Sbjct: 37 LTSNSCSPGDPLV 49 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P NSCSPGDPLV Sbjct: 14 PFRSNSCSPGDPLV 27 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 18 VSNSCSPGDPLV 29 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L NSCSPGDPLV Sbjct: 11 LTSNSCSPGDPLV 23 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 30 VSNSCSPGDPLV 41 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 74 IPLVPNSCSPGDPLV 30 + L NSCSPGDPLV Sbjct: 4 VSLSSNSCSPGDPLV 18 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 32 VSNSCSPGDPLV 43 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 17 VSNSCSPGDPLV 28 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 14 VSNSCSPGDPLV 25 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 34 VSNSCSPGDPLV 45 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P NSCSPGDPLV Sbjct: 62 PETSNSCSPGDPLV 75 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L NSCSPGDPLV Sbjct: 88 LTSNSCSPGDPLV 100 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 8 VSNSCSPGDPLV 19 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 10 VSNSCSPGDPLV 21 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 71 PLVPNSCSPGDPLV 30 P NSCSPGDPLV Sbjct: 52 PFRSNSCSPGDPLV 65 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 23 VSNSCSPGDPLV 34 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 18 VSNSCSPGDPLV 29 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L NSCSPGDPLV Sbjct: 11 LASNSCSPGDPLV 23 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L NSCSPGDPLV Sbjct: 3 LASNSCSPGDPLV 15 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L NSCSPGDPLV Sbjct: 15 LTSNSCSPGDPLV 27 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 193 VSNSCSPGDPLV 204 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 65 VPNSCSPGDPLV 30 V NSCSPGDPLV Sbjct: 9 VSNSCSPGDPLV 20 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 ++ NSCSPGDPLV Sbjct: 25 VISNSCSPGDPLV 37 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 68 LVPNSCSPGDPLV 30 L NSCSPGDPLV Sbjct: 11 LTSNSCSPGDPLV 23 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,523,618 Number of Sequences: 59808 Number of extensions: 369873 Number of successful extensions: 1714 Number of sequences better than 10.0: 310 Number of HSP's better than 10.0 without gapping: 1637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1710 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -