BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0306 (787 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 48 7e-06 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 44 1e-04 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 36 0.037 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.065 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 30 2.4 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_19590| Best HMM Match : RVT_thumb (HMM E-Value=5.3) 30 2.4 SB_6388| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_44556| Best HMM Match : RVP (HMM E-Value=2.3) 29 5.6 SB_36994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_46234| Best HMM Match : Herpes_BLRF2 (HMM E-Value=2.7) 28 9.9 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = +3 Query: 561 DEPNVVLRRLKNAHGTP*KGVGRS*QQDGGHWKSESAKECATTH 692 DEPN LR P KGVG S QQDGGH AKEC TTH Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNPAKECVTTH 46 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 48.4 bits (110), Expect = 7e-06 Identities = 29/61 (47%), Positives = 34/61 (55%) Frame = -1 Query: 631 ERPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRHQSPASSFE*AGVLTHLKFEN 452 E+PTPF G FGSS ASS YQN PT R P + + G+LT+LKFEN Sbjct: 58 EQPTPFVGSDERRLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTNLKFEN 116 Query: 451 R 449 R Sbjct: 117 R 117 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.8 bits (101), Expect = 8e-05 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +3 Query: 561 DEPNVVLRRLKNAHGTP*KGVGRS*QQDGGHWKSESAKECATT 689 DEPN LR P KGVG S QQDGGH KEC TT Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLKECVTT 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/49 (46%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = -1 Query: 652 WPPSCCH--ERPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 W P + E+PTPF G L FGSS ASSAYQ WPT + H Sbjct: 71 WLPQASYPCEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 119 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/60 (45%), Positives = 32/60 (53%), Gaps = 5/60 (8%) Frame = -1 Query: 676 SLADSDFQWPPSCCH-----ERPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 S++ +FQ P S H E+PTPF G L FGSS ASSAYQ WPT + H Sbjct: 19 SMSSPNFQGP-SRAHRTPQEEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 77 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/41 (51%), Positives = 24/41 (58%) Frame = -1 Query: 634 HERPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +E+PTPF G L FGSS ASSAYQ WPT + H Sbjct: 122 YEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 162 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/40 (52%), Positives = 23/40 (57%) Frame = -1 Query: 631 ERPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 E+PTPF G L FGSS ASSAYQ WPT + H Sbjct: 41 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 80 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/40 (52%), Positives = 23/40 (57%) Frame = -1 Query: 631 ERPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 E+PTPF G L FGSS ASSAYQ WPT + H Sbjct: 39 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 78 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/40 (52%), Positives = 23/40 (57%) Frame = -1 Query: 631 ERPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 E+PTPF G L FGSS ASSAYQ WPT + H Sbjct: 39 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTSNSH 78 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 40 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 40 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 40 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 40 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 40 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTKNSH 40 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 40 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 40 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 40 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 40 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 40 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 40 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSH 40 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNHAFGSSRIASSAYQKWPTRNSH 40 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/40 (50%), Positives = 22/40 (55%) Frame = -1 Query: 631 ERPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 E+PTPF G L FGSS ASSA Q WPT + H Sbjct: 58 EQPTPFVGSDERRLWHLNRAFGSSRIASSALQKWPTRNSH 97 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/39 (48%), Positives = 22/39 (56%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L +GSS ASSAYQ WPT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAYGSSRIASSAYQKWPTRNSH 40 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +3 Query: 636 QQDGGHWKSESAKECATTH 692 QQDGGH K ESAKEC TTH Sbjct: 2 QQDGGHGKLESAKECVTTH 20 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPT 524 +PTPF G L FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/44 (50%), Positives = 23/44 (52%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRHQSPAS 497 +PTPF G L FGSS ASSAYQN P R PAS Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/39 (48%), Positives = 21/39 (53%) Frame = -1 Query: 628 RPTPFHGVP*AFFRRLRTTFGSSHSASSAYQNWPTWHRH 512 +PTPF G L FGSS ASSAYQ PT + H Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKGPTRNSH 40 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +3 Query: 561 DEPNVVLRRLKNAHGTP*KGVGRS*QQDGGH 653 DEPN LR P KGVG S QQDGGH Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGH 33 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -2 Query: 249 FPLTST*PGIVHHLSGPSICA 187 FPL S GIVHHLSGP+ CA Sbjct: 9 FPLASPYSGIVHHLSGPNRCA 29 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -1 Query: 253 RVSPDFDLTRHSSPSFGSQHLCS 185 RVS F L RHSSPSFGSQ + S Sbjct: 42 RVSSGFTLFRHSSPSFGSQQMRS 64 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +3 Query: 657 KSESAKECATTHCRSNQPENXLALKRFAYTL 749 K ESAKEC TTH +ALKR YT+ Sbjct: 2 KVESAKECVTTHLPKQLALKMMALKRRTYTV 32 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 322 ISLSPLYPVPTIDLHVR 272 ISLSPLYP TIDLHVR Sbjct: 38 ISLSPLYPNLTIDLHVR 54 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 654 WKSESAKECATTH 692 WK ESAKEC TTH Sbjct: 7 WKLESAKECVTTH 19 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 654 WKSESAKECATTH 692 WK ESAKEC TTH Sbjct: 7 WKLESAKECVTTH 19 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 654 WKSESAKECATTH 692 WK ESAKEC TTH Sbjct: 86 WKLESAKECVTTH 98 >SB_19590| Best HMM Match : RVT_thumb (HMM E-Value=5.3) Length = 243 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/64 (29%), Positives = 31/64 (48%) Frame = -2 Query: 663 PTSNGHRPAVMSDQRLFMVSHERFLGALELRLVHPTAPVLLTKIGPLGTVISLRLHRSSK 484 P + H ++++ + E F+ LRL+HP+ P L+ + GT + R S K Sbjct: 126 PNNLTHHGEQVTEEEELSPTLENFIVLTWLRLIHPSLPRLVKQ--RYGTELRSRTLASIK 183 Query: 483 PEFS 472 PE S Sbjct: 184 PEIS 187 >SB_6388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1520 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 637 SRTVAIGSRNPLRSVXRLTAEATSLKXXWR*NVLPI 744 SR+++I RNP+ + RL A A+S WR N+ + Sbjct: 25 SRSLSITVRNPVVARSRLLAPASSCLSCWRRNIADV 60 >SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1115 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +3 Query: 225 LVRSKSGETLWRTVA--ILTCKSIVGTGYRG 311 L++SK E +W +LTC S +GTG RG Sbjct: 603 LIKSKGYEFMWNEHLGYVLTCPSNLGTGLRG 633 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 228 VRSKSGETLWRTVA--ILTCKSIVGTGYRG 311 ++SK E +W +LTC S +GTG RG Sbjct: 235 IKSKGREFMWNKHLGYVLTCPSNLGTGLRG 264 >SB_44556| Best HMM Match : RVP (HMM E-Value=2.3) Length = 305 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/64 (28%), Positives = 30/64 (46%) Frame = -2 Query: 663 PTSNGHRPAVMSDQRLFMVSHERFLGALELRLVHPTAPVLLTKIGPLGTVISLRLHRSSK 484 P + H ++++ + E + LRL+HP+ P L+ + GT + R S K Sbjct: 11 PNNQTHHGEQVTEEEELSPTLENLIVLTWLRLIHPSLPRLVKQ--RYGTELRSRTLASIK 68 Query: 483 PEFS 472 PE S Sbjct: 69 PEIS 72 >SB_36994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 195 CWDPKDGELCLVRSKSGETLWR 260 C KD +LC+ ++G TLWR Sbjct: 589 CCSCKDYDLCIFGRRAGNTLWR 610 >SB_46234| Best HMM Match : Herpes_BLRF2 (HMM E-Value=2.7) Length = 271 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/64 (28%), Positives = 30/64 (46%) Frame = -2 Query: 663 PTSNGHRPAVMSDQRLFMVSHERFLGALELRLVHPTAPVLLTKIGPLGTVISLRLHRSSK 484 P + H ++++ + E + LRL+HP+ P L+ + GT + R S K Sbjct: 31 PNNLTHHGEQVTEEEELSPTLENLIVLTWLRLIHPSLPRLIKQ--RYGTELRSRTLASIK 88 Query: 483 PEFS 472 PE S Sbjct: 89 PEIS 92 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,884,490 Number of Sequences: 59808 Number of extensions: 520654 Number of successful extensions: 1206 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 1090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1205 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -