BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0306 (787 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 28 0.38 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 28 0.38 CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 26 1.1 AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 26 1.1 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 3.5 AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 23 8.1 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 27.9 bits (59), Expect = 0.38 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 642 PAVMSDQRLFMVSHERFLGAL 580 P V DQRLFM+ ++FL AL Sbjct: 515 PMVFRDQRLFMIELDKFLVAL 535 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 27.9 bits (59), Expect = 0.38 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 642 PAVMSDQRLFMVSHERFLGAL 580 P V DQRLFM+ ++FL AL Sbjct: 515 PMVFRDQRLFMIELDKFLVAL 535 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 26.2 bits (55), Expect = 1.1 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 521 PSGPILVSRTGAVG*T--KRSSKAPKKRSWDTMKRRWSLMTA 640 PS P + R+G + T +R+ PK+ S + ++ W+L A Sbjct: 222 PSSPPAIRRSGTLEVTFSERTFVTPKRESMEQAEQEWTLKQA 263 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 26.2 bits (55), Expect = 1.1 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 521 PSGPILVSRTGAVG*T--KRSSKAPKKRSWDTMKRRWSLMTA 640 PS P + R+G + T +R+ PK+ S + ++ W+L A Sbjct: 222 PSSPPAIRRSGTLEVTFSERTFVTPKRESMEQAEQEWTLKQA 263 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 24.6 bits (51), Expect = 3.5 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 5/53 (9%) Frame = +2 Query: 80 RTLDVRSGRMKL-SSYVRD----FRTPEASRFQSVNEGAL*AQMLGPERW*TM 223 RT V +G ++ SY +D + T E +SV G +LGP W TM Sbjct: 588 RTKRVPAGLQRIIHSYFQDRELVYETSEGPVVRSVTAGVPQGSILGPTLWNTM 640 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 23.4 bits (48), Expect = 8.1 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 309 PYTQFRRSICTSESLRSSTGFP 244 P+T F RSIC E S+ P Sbjct: 260 PFTDFLRSICLPEQNFESSATP 281 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 800,649 Number of Sequences: 2352 Number of extensions: 17448 Number of successful extensions: 70 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -