BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0306 (787 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.4 DQ485319-1|ABF21078.1| 175|Apis mellifera icarapin variant 2 pr... 23 4.3 DQ485318-1|ABF21077.1| 223|Apis mellifera icarapin variant 1 pr... 23 4.3 AY939856-1|AAX33236.1| 223|Apis mellifera venom carbohydrate-ri... 23 4.3 AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. 23 4.3 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 7.4 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 7.4 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 7.4 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 9.8 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 9.8 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 9.8 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 9.8 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.4 bits (48), Expect = 2.4 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = -1 Query: 508 SPASSFE*AGVLTHLKFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGN 353 S A+S E + TH + ++LR R S L DE K + ++ EGN Sbjct: 220 STAASDEDISLTTHQQKRHKLRVTRCYSSDSAVLSDEDQTKGWDGSNMVEGN 271 >DQ485319-1|ABF21078.1| 175|Apis mellifera icarapin variant 2 precursor protein. Length = 175 Score = 22.6 bits (46), Expect = 4.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 331 DGSISLSPLYPVPTIDLHVRIATVLHRVSPDFD 233 DGS S L V ID+ + T+L VS + D Sbjct: 100 DGSDDYSTLIRVRVIDVRPQNETILTTVSSEAD 132 >DQ485318-1|ABF21077.1| 223|Apis mellifera icarapin variant 1 precursor protein. Length = 223 Score = 22.6 bits (46), Expect = 4.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 331 DGSISLSPLYPVPTIDLHVRIATVLHRVSPDFD 233 DGS S L V ID+ + T+L VS + D Sbjct: 148 DGSDDYSTLIRVRVIDVRPQNETILTTVSSEAD 180 >AY939856-1|AAX33236.1| 223|Apis mellifera venom carbohydrate-rich protein precursor protein. Length = 223 Score = 22.6 bits (46), Expect = 4.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 331 DGSISLSPLYPVPTIDLHVRIATVLHRVSPDFD 233 DGS S L V ID+ + T+L VS + D Sbjct: 148 DGSDDYSTLIRVRVIDVRPQNETILTTVSSEAD 180 >AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. Length = 223 Score = 22.6 bits (46), Expect = 4.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 331 DGSISLSPLYPVPTIDLHVRIATVLHRVSPDFD 233 DGS S L V ID+ + T+L VS + D Sbjct: 148 DGSDDYSTLIRVRVIDVRPQNETILTTVSSEAD 180 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 7.4 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 316 LSPLYPVPTID 284 LSP+YP P +D Sbjct: 71 LSPIYPSPMVD 81 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -3 Query: 308 PIPSSDDRFARQNRYGPPQGFP*LRPDQA 222 P S ++ R GPP FP P A Sbjct: 364 PFVSIQEQIPRLRYIGPPTSFPRFIPPNA 392 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 7.4 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 316 LSPLYPVPTID 284 LSP+YP P +D Sbjct: 71 LSPIYPSPMVD 81 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -3 Query: 308 PIPSSDDRFARQNRYGPPQGFP*LRPDQA 222 P S ++ R GPP FP P A Sbjct: 364 PFVSIQEQIPRFRYIGPPTSFPRFIPPNA 392 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -3 Query: 308 PIPSSDDRFARQNRYGPPQGFP*LRPDQA 222 P S ++ R GPP FP P A Sbjct: 364 PFVSIQEQIPRFRYIGPPTSFPRFIPPNA 392 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -3 Query: 308 PIPSSDDRFARQNRYGPPQGFP*LRPDQA 222 P S ++ R GPP FP P A Sbjct: 364 PFVSIQEQIPRFRYIGPPTSFPRFIPPNA 392 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -3 Query: 308 PIPSSDDRFARQNRYGPPQGFP*LRPDQA 222 P S ++ R GPP FP P A Sbjct: 353 PFVSIQEQIPRFRYIGPPTSFPRFIPPNA 381 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,847 Number of Sequences: 438 Number of extensions: 4998 Number of successful extensions: 14 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -