BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0302 (468 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 25 0.31 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 25 0.31 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 3.8 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 25.4 bits (53), Expect = 0.31 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 12 RTVPVGAWAGVNDGSALVKNEQRQRHARHR 101 + VP W GV GSA E+RQ + H+ Sbjct: 157 KRVPPTNWVGVFGGSAWSWREERQAYYLHQ 186 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 25.4 bits (53), Expect = 0.31 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 12 RTVPVGAWAGVNDGSALVKNEQRQRHARHR 101 + VP W GV GSA E+RQ + H+ Sbjct: 157 KRVPPTNWVGVFGGSAWSWREERQAYYLHQ 186 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.8 bits (44), Expect = 3.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 21 PVGAWAGVNDGSALVKNEQRQRHARHR 101 P W V GSA NE+R+++ H+ Sbjct: 160 PPNNWLSVFWGSAWQWNEERKQYYLHQ 186 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,005 Number of Sequences: 438 Number of extensions: 2033 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12559158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -