BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0300 (409 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18657| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.36 SB_43636| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-31) 29 1.5 >SB_18657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.1 bits (67), Expect = 0.36 Identities = 16/68 (23%), Positives = 34/68 (50%) Frame = -3 Query: 407 FSYHRLSNFIFFILYPFTFSFSILRISNFSSPFILIFFLDLHTMLF*TVTMLFVYVSLIL 228 F YH+L + + F L + + + L+ + + + F+D LF T +L + S+++ Sbjct: 108 FQYHQLRDLLRFCLGECSVTLNPLKGNTSCIGYSMAMFMDAEERLFPTPALLNTFSSMLI 167 Query: 227 VISCPLLK 204 V+ +K Sbjct: 168 VLRSTTVK 175 >SB_43636| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-31) Length = 355 Score = 29.1 bits (62), Expect = 1.5 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Frame = -2 Query: 366 IPLYVQFLYFTDIQFL-----FAFYLNLLSGPPHDAVLDCDYAFCLCFFNSRYIL 217 I L++ L TD+ L FAF + +L P+ + Y FC+ FF S +L Sbjct: 60 IYLFIGALALTDVSLLATYPFFAFPVTVLGKWPYSDFVCQSYGFCILFFASASLL 114 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,513,667 Number of Sequences: 59808 Number of extensions: 149711 Number of successful extensions: 349 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 349 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -